SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1P2J1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1P2J1
Domain Number 1 Region: 71-202
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.79e-48
Family Regulator of G-protein signaling, RGS 0.000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1P2J1
Sequence length 209
Comment (tr|G1P2J1|G1P2J1_MYOLU) Regulator of G protein signaling 1 {ECO:0000313|Ensembl:ENSMLUP00000004081} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=RGS1 OC=Vespertilionidae; Myotis.
Sequence
MRGAAMPAPRLHKMPGMLFSAPPKELQGTDHSLLDDKTQKRRPKTFGMDVKAYLRSMIPH
LESGMKPSRSKDILSADEVLQWSQSLEKLLANRAGQDVFGSFLKSEFSEENIEFWLACED
YKRTESDLLHGKAEKIYKSFVHSDAAKQINIDFHTRESTAKKIKAPTPTCFDEAQKIVYT
LMEKDSYPRFLKSNIYLNLLNDLQANSLK
Download sequence
Identical sequences G1P2J1
ENSMLUP00000004081 ENSMLUP00000004081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]