SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1P2K7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1P2K7
Domain Number 1 Region: 588-727
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-46
Family Phosphotyrosine-binding domain (PTB) 0.000015
Further Details:      
 
Domain Number 2 Region: 451-573
Classification Level Classification E-value
Superfamily SH2 domain 1.62e-21
Family SH2 domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1P2K7
Sequence length 733
Comment (tr|G1P2K7|G1P2K7_MYOLU) Tensin 4 {ECO:0000313|Ensembl:ENSMLUP00000004098} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=TNS4 OC=Vespertilionidae; Myotis.
Sequence
MPSPLLAGGHAVCLPPCEEPRRVLHPAPSPNLPPPYPYYTTEGWGAQALMASTPCKEPPN
RLQQAPQAGAKASCLLRSPGEQSGALEDLDSYIGFSLESLNQMILELDPTFQLLPTGSGG
PWAEPTQSTTSQRKKEEPEALDIKYIEVTSARSRCHDGPQRCSSPSVTPPFGSPRNGGLL
LSRDVPRETRSSSESLIFSGNQGIGHQRPPPPPGALSSHPPPSPSISIPCTRSKASGPHG
FGSPLMASPGLEKGLGGPATLGGNGVSMVSAHPATDVSYVFGSSQSLLRSSISSPQSSSR
SLESPASSSSSLHSLGPGSLCTRASDNQVPSSTTPSRGQPRVACSPPLDKEHASSCPPSI
ANSMVDIPIVLINGCPEPGSSPPQRTPGPQDFVRPGAAPANNPCPATRSHSQTLPDASPT
ASPHVCFGFLSQTESIPKVPLLCSSPGPARDMQPTMKFVMDTSKYWFKPSITREQAIELL
RKEEPGAFVVRDSSSFRGSFGLALKVQEAPAPAQNRSGEDSSDLIRHFLIESSAKGVHLK
GADEEPYFGSLSAFVCQHSIMPLALPCKLTIPQKEMGGGDGASDPATDSRASCLKRSAGC
HVLYLSSVSVETLTGALAVQKAISAILERDVLPTPTVVHFKVTEQGITLTDVQRKVFFRR
HYPLSTLRFCGMDPEQRKWQKYCKPSWIFGFVAKSQTNSQENVCHLFAEYDTVQPASQVI
SLVGALLQDTERM
Download sequence
Identical sequences G1P2K7
ENSMLUP00000004098 ENSMLUP00000004098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]