SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1P2Z5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1P2Z5
Domain Number 1 Region: 215-325
Classification Level Classification E-value
Superfamily Cadherin-like 3.01e-27
Family Cadherin 0.0000143
Further Details:      
 
Domain Number 2 Region: 434-562
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-24
Family Cadherin 0.00021
Further Details:      
 
Domain Number 3 Region: 327-439
Classification Level Classification E-value
Superfamily Cadherin-like 3.27e-24
Family Cadherin 0.0000161
Further Details:      
 
Domain Number 4 Region: 118-213
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000991
Family Cadherin 0.0000198
Further Details:      
 
Domain Number 5 Region: 547-649
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000328
Family Cadherin 0.0000595
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1P2Z5
Sequence length 835
Comment (tr|G1P2Z5|G1P2Z5_MYOLU) Cadherin 3 {ECO:0000313|Ensembl:ENSMLUP00000004261} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=CDH3 OC=Vespertilionidae; Myotis.
Sequence
MGLPSGSLASLLFHLFLLLQVCWLPCAASEPCRADPGGAEVTLEAGGAELEPGQAPGRVF
MGCPGQESALLSTDQDFTALNDTTVQLRGLLSLQESKALRTSPSKRILRRRKREWVFPPL
SVPENGKGPFPQRLNQLKSSKDRGTKIFYSITGPGADSPPEGVFTIEKETGWLLLNKPLD
REKIAKYELFGHAVSENGASVEDPMNISIIVTDQNDHKPKFTQDVFKGSVLEGALPGTSV
MQVTATDEDDAINTYNGVVAYSIHSQEPKDPPNMFTIHRSTGTISVISSGLDREKVPEYT
LTVQATDLDGEGSTTTAVAIVAVLDANDNAPVFDPQKYEAHVPENAVGREVQRLTVTDLD
APNSPAWRATYRILEGDSGDHFTITTHPESNQGILTTKKGLDFEAKNQHTLYIEVTNEAP
FAVKLPTSTATVVVHVEDVNEAPVFVPPSNVVEVQENISAGEPVCTYTAQDPDRGSQRVS
YHILRDPAGWLAMDPDSGQVTAAGVLDREDERFVRNNIYEVMVLATDDGSPPATGTGTLL
LTLVDVNDHGPVPEPRQITICNQSPVPQVLNITDKDLSPHTSPFKAQLTQDSDIYWTAKV
NEKGDTVALSLKKFLKQDTYDVHLSLSDRGNKQQLAVIKATVCDCHGHVETCPERWKGGF
LLLPILGAVLALLFLLVLLLLLVRKKQKVKEPLLLPEDDTRDNVFYYGEEGGGEEDQDYD
ITQLHRGLEARPKVVLRNDVAPAFIPTPMYRQRPANPDEIGNFITENLKAANTDPTAPPY
DSLLVFDYEGCGSEAPSLSSLTSSASDQDQDYDYLNEWGSRFKKLADMYGAGQDD
Download sequence
Identical sequences G1P2Z5
ENSMLUP00000004261 ENSMLUP00000004261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]