SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1P381 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1P381
Domain Number 1 Region: 172-312
Classification Level Classification E-value
Superfamily PH domain-like 4.61e-36
Family Third domain of FERM 0.0031
Further Details:      
 
Domain Number 2 Region: 68-174
Classification Level Classification E-value
Superfamily Second domain of FERM 2.09e-29
Family Second domain of FERM 0.0000989
Further Details:      
 
Domain Number 3 Region: 2-66
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.05e-21
Family First domain of FERM 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1P381
Sequence length 546
Comment (tr|G1P381|G1P381_MYOLU) FERM domain containing 5 {ECO:0000313|Ensembl:ENSMLUP00000004364} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=FRMD5 OC=Vespertilionidae; Myotis.
Sequence
LQRDAKGQYLFDLLCHHLNLLEKDYFGIRFVDPDKQRHWLEFTKSVVKQLRSQPPFTMCF
RVKFYPADPAALKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQEAEIGDYDPG
KHPEGYSSKFQFFPKHSEKLERKIAEIHRTELSGQTPATSELNFLRKAQTLETYGVDPHP
CKDVSGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKLKFEGKTFYLYVSQKEEKKIILT
YFAPTPEACKHLWKCGIENQAFYKLEKSSQVRTVSSSNLFFKGSRFRYSGRVAKEVMESS
AQIKREPPEIHSLRAGMVPSRSCPSITHGPRLSSVPRTRRRAVHISIMEGVPLRKAPDRC
APQPPGSHLWARQSAGAPPREHSGRADSNERVAVIADEAYSPADSMLPTPVAEHSLELML
LSRQINGATCSIEEEKESEASTPTAADVEALGGELRALCQGHGRPEEEQVNKFVLSVLRL
LLVTMGLLFVLLLLLIILTESDLDIAFFRDIRQTPEFEQFHYQYFCPLRRWFACKIRSVV
SLLIDT
Download sequence
Identical sequences G1P381
ENSMLUP00000004364 ENSMLUP00000004364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]