SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1P3A9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1P3A9
Domain Number 1 Region: 17-283
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 3.98e-40
Family PhyH-like 0.065
Further Details:      
 
Domain Number 2 Region: 828-885
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 5.64e-22
Family Tudor domain 0.00038
Further Details:      
 
Domain Number 3 Region: 886-941
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000000102
Family Tudor domain 0.00022
Further Details:      
 
Domain Number 4 Region: 662-698
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000709
Family PHD domain 0.019
Further Details:      
 
Weak hits

Sequence:  G1P3A9
Domain Number - Region: 757-794
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00775
Family PHD domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1P3A9
Sequence length 1006
Comment (tr|G1P3A9|G1P3A9_MYOLU) Lysine demethylase 4C {ECO:0000313|Ensembl:ENSMLUP00000004394} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=KDM4C OC=Vespertilionidae; Myotis.
Sequence
VIPPKEWKPRQCYDDIDNLLIPAPIQQMVTGQSGLFTQYNIQKKAMTVKEFRQLANSGKY
CTPRYLDYEDLERKYWKNLTFVAPIYGADINGSIYDEGVAEWNIARLNTILDVVEEECGI
SIEGVNTPYLYFGMWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAQGF
FPSSFQGCDAFLRHKMTLISPSVLKKYGIPFDKITQEAGEFMITFPYGYHAGFNHGFNCA
ESTNFATVRWIDYGKVAKLCTCRNDMVKISMDIFVKKFQPDRYQLWKQGKDIYTIDHTKP
TPETTPEVKAWLQRRRKIRASRSFQCTSSHSKRPKNEEDEEVSAAVDGAQGPTPDPDPDP
DDLKVSEQPEAAVKLENIEAPSEGVASARRMQLDQNLLDNIGLSGNSCLSTSVKEEIKTK
DDQAYAIIPSSNTRETADSISIGHLTPKESDPPKHPWPKLPELCSSVPESNSWLTEGEGS
NVESRVSGLEPGEVPAVPSGERNGFRVPSRIEGETKTAKSWRHPLSKPPARSPMTLVKQQ
ATSDEELPEVPLIEEEVEETESWAKPLVHLWQTKAPNFVAEQEYNAAMGRMEPHCAICAL
LMPYYKPESSNEENDSRWETKLDDMVASGGKTKPLIPEMCFIYSEENIEYSPPNAFLEED
GTSLLISCAKCCVRVHASCYGIPSHEISDGWLCVRCKRNAWTAECCLCNLRGGALKETKD
NKWAHVMCAVAVPEVRFTNVPERTQIDVGRIPLQRLKLKCIFCRYRVKKVSGACIQCSYG
RCPVSFHVTCAHAAGVLMEPDDWPYVVNITCFRHKANPNMKLKAGERGISVGQTVITKHR
NTRYYSCRVIAVTSQTFYEVMFDDGSFSRDTFPEDIVSRDCVKLGPPAEGEVVEVKWPDG
KLYGAKYLGLNVAHMYQVEFEDGSQIAMKREDIYTLDEELPKRVKARFSTASDMRFEDTF
YGADIIQGEKKRQRVLSSRFKNEYVDDPVYRTFLRSSFQKKCQKRQ
Download sequence
Identical sequences G1P3A9
ENSMLUP00000004394 ENSMLUP00000004394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]