SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1P415 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1P415
Domain Number 1 Region: 1-227
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.23e-64
Family IMD domain 0.00000236
Further Details:      
 
Domain Number 2 Region: 320-383
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000433
Family SH3-domain 0.0000801
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1P415
Sequence length 501
Comment (tr|G1P415|G1P415_MYOLU) BAI1 associated protein 2 like 1 {ECO:0000313|Ensembl:ENSMLUP00000004680} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=BAIAP2L1 OC=Vespertilionidae; Myotis.
Sequence
FQNVMEQFNPRLRNLINLGKNYEKAVNAMILAGKAYYDGVAKIGEIATGSPVSTELGHVL
IEISSTHQKLDESFRENFKAFHKEIIHELEKKTELDVKYMTXLKKIPQTRHPGKSPSWIV
KRDSERKKSNGGRNCQSISDTKYIETVTSRQSEIQRFIAEGCREALLEEKRRFCFLVDKH
CSFASRTQHYHLQSAELLNSKLPRWQKTCGDATKVPEEIINMIEEIKTPSSTPTSWTPQP
SPMVQRSSVAGKDYDTLSKYPPKVPPAPSGRVVTSPLIDMFNNPATAAQNSGKAITTVLS
SASSEDPSLQRSVSVATGLNMMKRQKVKTIFPHTAGTNQLGFEQGDVITLLVAEERDGWL
YGEHDTSKARGWFPSSYTRLLEESAQEAVSVPAPSPAPVRSMSTVDLSEKSCAAVPIPPP
DYLECLSMRAAADNSNSENSSKMKSYDALLSPETASPFHTPSPRNNTNGTAKLPFLSGEN
PFATVKLRPTVTNDRSAPIIR
Download sequence
Identical sequences G1P415
ENSMLUP00000004680 ENSMLUP00000004680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]