SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1P4R4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1P4R4
Domain Number 1 Region: 321-447
Classification Level Classification E-value
Superfamily SH2 domain 7.14e-26
Family SH2 domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1P4R4
Sequence length 450
Comment (tr|G1P4R4|G1P4R4_MYOLU) Src homology 2 domain containing E {ECO:0000313|Ensembl:ENSMLUP00000004957} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=SHE OC=Vespertilionidae; Myotis.
Sequence
GPLMAAKVGSRRSPLNLKTVSERAKPGGGGGKPRKNSEAGGAVPPAGKGRKNSVAELGGG
RAGLAPPKDSRLSRESLQGLIQAAAGKSRKNSRTTDEEPHRGAAKSSGCSTYINRLIKVD
TQEKNGKSSYPSSSSSLGPELDKGKIIKQQDTVIILEDYADPYDAKRTKGQRDAERVGEN
DGYMEPYDAQQMITEIRRRGSKDPLVKALQLLDSPCEPGEPGVKPEALARRRSSKDLLGK
PPQLYDTPYEPADGGPERKARPPDAHGRLPQDDERPAAEYEQPWEWKKEQIVRALSVQFE
GSERPSVKEEPARQHHRQKSWTQKILKPALSDHGEGERVDPALPLEKQPWYHGAITRAEA
ESRLQPCKEAGYLVRNSESGTSRYSIALKTSQGCVHIIVAQTKDNKYTLNQTSAVFDSIP
EVVHYYSNEKLPFKGAEHMTLLYPVHNKLH
Download sequence
Identical sequences G1P4R4
ENSMLUP00000004957 ENSMLUP00000004957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]