SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1P4Y8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1P4Y8
Domain Number 1 Region: 285-590
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 3.53e-124
Family Mammalian PLC 0.000000282
Further Details:      
 
Domain Number 2 Region: 129-284
Classification Level Classification E-value
Superfamily EF-hand 7.5e-46
Family EF-hand modules in multidomain proteins 0.01
Further Details:      
 
Domain Number 3 Region: 610-726
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.57e-28
Family PLC-like (P variant) 0.0008
Further Details:      
 
Domain Number 4 Region: 1-110
Classification Level Classification E-value
Superfamily PH domain-like 4.01e-25
Family Pleckstrin-homology domain (PH domain) 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1P4Y8
Sequence length 732
Comment (tr|G1P4Y8|G1P4Y8_MYOLU) Phosphoinositide phospholipase C {ECO:0000256|RuleBase:RU361133} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN= OC=Vespertilionidae; Myotis.
Sequence
CMSVMQSGTQMIKLKRGTKGLVRLFYLDEHRTRLRWRPSRKSEKAKILIDSIYKVTEGRQ
SEIFHRQAEGNFDPSCCFTIYHGNHMESLDLITSNPEEARTWITGLKYLMAGIRQYMEYC
EGKKDTKCFCMWVKQTFEEADKNGDGLLNIEEIHQLMHKLNVNLPRRKVRQMFQEADTDE
NQGTLTFEEFCVFYKMMSLRRDLYLLLLSYSDKKDHLTVEELAQFLKVEQKMNNVTTDYC
LDIIRKFEVSEENKAKNVLGIEGFTSFMRSPACDIFNPLHHEVYQDMDQPLCNYYIASSH
NTYLTGDQLLSQSKVDMYARVLQEGCRCVEVDCWDGPDGEPVVHHGYTLTSKIPFRDVVE
TINKHAFVKNEFPVILSIENHCSVQQQRKIAQYLKGIFQDKLDLSSIDPGETKQLPSPQS
LKGKILVKGKKLPYHLGDDAEEGDVSDEDSADEIEARTMDGRLGRRRKTMKLCRELSDLV
VYTNSVAAQDIVDDGTTGNVLSFSETRAHQVVQQKSEQFMIYNQKQLTRIYPSAYRIDSS
NFNPLPYWNAGCQLVALNYQSEGRIMQLNRAKFKTNGNCGYVLKPQQIRDSLGTFNPFSG
DPLPANPKKQLILKVISGQQLPKPPDSMFGDRGEIIDPFVEVEIIGLPVDCCKDQTRVVD
DNGFNPVWEETLTFTVHMPEIALVRFLVWDHDPIGRDFVGQRTVTFSSLVPGYRHVYLEG
LTEASIFVHITI
Download sequence
Identical sequences G1P4Y8
ENSMLUP00000005045 ENSMLUP00000005045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]