SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1P517 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1P517
Domain Number 1 Region: 20-177
Classification Level Classification E-value
Superfamily alpha-ketoacid dehydrogenase kinase, N-terminal domain 1.07e-57
Family alpha-ketoacid dehydrogenase kinase, N-terminal domain 0.000000448
Further Details:      
 
Domain Number 2 Region: 229-375
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.27e-28
Family alpha-ketoacid dehydrogenase kinase, C-terminal domain 0.00000345
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1P517
Sequence length 410
Comment (tr|G1P517|G1P517_MYOLU) Pyruvate dehydrogenase kinase 1 {ECO:0000313|Ensembl:ENSMLUP00000005079} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=PDK1 OC=Vespertilionidae; Myotis.
Sequence
IGFGFAFRPGGRARGSRGKVEFLGLSSPSPFSMKQYLGFGSVNACEKTSFMFLRQELPVR
LANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIR
NRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYFLDRFFMSRISIRMLLNQHSLLFGGKD
KGSPSHRKHIGSINPNCNVVEVIQDGYESARRLCDLYYINSPELELEELNAKSPGQPIQV
VYVPSHLYHMVFELFKNAMRATMEYHADKGVYPPVQVHVTLGSEDLTVKMSDRGGGVPLR
KIDRLFNYMYSTAPRPRVETSRAAPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAV
IFIKALSTESIEKLPVYNKAAWKHYKTIHEADDWCVPSREPKDMTTFRSA
Download sequence
Identical sequences G1P517
ENSMLUP00000005079 ENSMLUP00000005079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]