SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1P526 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1P526
Domain Number 1 Region: 2957-3125
Classification Level Classification E-value
Superfamily Cyclophilin-like 2.05e-66
Family Cyclophilin (peptidylprolyl isomerase) 0.000000801
Further Details:      
 
Domain Number 2 Region: 1136-1268
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-48
Family Ran-binding domain 0.000000357
Further Details:      
 
Domain Number 3 Region: 2217-2347
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-45
Family Ran-binding domain 0.0000443
Further Details:      
 
Domain Number 4 Region: 2808-2947
Classification Level Classification E-value
Superfamily PH domain-like 3.44e-45
Family Ran-binding domain 0.0000306
Further Details:      
 
Domain Number 5 Region: 1919-2050
Classification Level Classification E-value
Superfamily PH domain-like 8.76e-44
Family Ran-binding domain 0.00000107
Further Details:      
 
Domain Number 6 Region: 7-167
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000759
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 
Domain Number 7 Region: 1628-1654
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000216
Family Ran binding protein zinc finger-like 0.002
Further Details:      
 
Domain Number 8 Region: 1687-1715
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000275
Family Ran binding protein zinc finger-like 0.0014
Further Details:      
 
Domain Number 9 Region: 1569-1595
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000863
Family Ran binding protein zinc finger-like 0.002
Further Details:      
 
Domain Number 10 Region: 1443-1469
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000112
Family Ran binding protein zinc finger-like 0.0021
Further Details:      
 
Domain Number 11 Region: 1380-1406
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000183
Family Ran binding protein zinc finger-like 0.0019
Further Details:      
 
Domain Number 12 Region: 1506-1531
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000126
Family Ran binding protein zinc finger-like 0.0019
Further Details:      
 
Weak hits

Sequence:  G1P526
Domain Number - Region: 1318-1344
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000824
Family Ran binding protein zinc finger-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1P526
Sequence length 3125
Comment (tr|G1P526|G1P526_MYOLU) RAN binding protein 2 {ECO:0000313|Ensembl:ENSMLUP00000005088} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=RANBP2 OC=Vespertilionidae; Myotis.
Sequence
KSMKGFYFAKLYYEAKEYDLAKKYISTYINVQERDPKAHRFLGLLYEVEENIDKAVECYK
RSVELNPTQKDLVLKIAELLCKNDVTDGRAKYWVERAAKLFPGSPAIYKLKEQLLDCKGE
DGWNKLFDLIQSELYARPDDVYVNIRLVELYRSNKRLKDAVAHCHEAERNVALRSSLEWN
LCVVQTLKEYLESDKSNRQATSKDLLLAYANLMLLTLSTRDMQESRDLLESFDGALQSVK
SCMGGNDELLAIFLEIKGHFYMHAGSLLLKMGQHSDVQWRALSELAALCYLIAFQVPRPK
IKLIKGEGGQNLLETMAFDRLSQSGHMLLNLSRDKQDFLKEVVESFANKSGQSALYDALF
SGQSPKDSSFLGSDDIGNIDVQAPKIDDLARYDVGAIRAHNGSLQHLTWLGLQWNLLPTL
PAIRKWLKQLFHHLPQETSRLETNAPESICILDLEVFLLGVIYNSQLQLKEKCSSHYNFY
QPLCLPFPVCKQLYTERQKSWWDAVCNLIHRKAIPGTSAKLRLLVQRDINTLRGQEKHGL
QPALLIHWATYLQKTGIDLNSFYDQREYIGRSVHYWKKVLPLLKMIKKKISIPEPTDPLF
KHFHSADIQASEIGEYEEEAHITFAILDAVNGNIEDAMTAFESIKNVVSYWNLALIFHRK
AEDIENDAHSPEEQEECKNYLRKTRDYLMKILDDSDSNLSVVKKLPVPLESVEDMLNSVK
QQLDDYSEGGPLYKNGSLRNTDSEMKYSTPSPTKYSLSPSKSYKYSPKAPPQWAEDQNSL
LKMICQEVEAIKKEMQELKLNSSNLGSPHRWPTECYGPDSVPDGYQGSQTFHGAPLTVAT
TGTSVYYSQSPAYNSQYLLRPAANVTPTKGPVYGMNRLPPQQHIYAYSQQMHTPPVQNTS
ACMFSQEMYGPPLRFESPATGILSPRGDDYFNYNIQQTSTNPPLPEPGYFTKPPVAAHAS
RSAESKVIEFGKTNFVQPMPGEGIRPSLTAPAHTTQPPPFKFNSNFKSNDGDFTFSSPQV
VTQPPSMTYNNSESLLGLLTSEKPLQGDGYSGAKASQTIGSRNTFNFGSKNVPGISFTEN
IGPNQKNSGFCRSDDMFTFHGPGKSVFGTPAPEVANKNHEADGGSAHGDDDDDGPHFEPV
VPLPDKIEVKTGEEDEEEFFCNRAKLFRFDAESKEWKERGIGNVKILRHKTSGKIRLLMR
REQVLKICANHYISPDMKLTPNAGSDRSFVWHALDYADEFPKPEQLAIRFKTPEEAALFK
CKFEEAQNILKASGAKVTTTNKAMRIVKEPASHGNKDICKSDARNMNFEFQVAKKEGSWW
HCDSCSLKNAATAKKCVSCQNLNPSNKELLGPPLVETIPTLKTSPENTPDRFALMIPKNE
GHWDCSICLVRNEPTVSRCIACQNTKSANKSGSFFVQQPSFKFGQGDLPKSVNNDFRSVF
SVKEGQWDCSVCLVQNEGSSSRCVACDNSRKQNLPTVSAPASCKFGASEINKTPKSGFED
MFAKKDGQWDCSVCLVRNEANAAKCAACHNPGKPSVSSSAVPVPASFKFSTSETSKATKS
GFEGLFTKKEGQWDCSVCFVRNEASTTKCVACQNPSAQNQPTPAVSAPTSSETSKVTKSG
FEGMFTKKEGQWDCSVCFVRNEASTTKCVACQNPSAQNQPTPAVSASASSETSKATKSGF
EGIFTKKEGQWDCSVCFVQNESSSLKCVACDASKPTHKPIPETPSAFTLGSKAKLSDSSG
NQVGTGFKSNFSEKAFKFGITEQGFKFGHVDQENIPSFTFQSSNTDSNSTIEGFNFSVPV
LADGFKFGIQELGNQEKKSEKPLENDNDFQAQGVSSQKNDTGVILGQTGSTFTFADLAKS
TSGEGFQFGKKDPNFKGFSGAGEKLFSLQSGKKADKADTSTDLEKDDDAYKTEDSDDIHF
EPVVQMPEKVELVTGEEDEKVLYSQRVKLFRFDAEISQWKERGLGNLKILKNEVNGKLRM
LMRREQVLKVCANHWITTTMNLKPLSGSDRAWMWLASDFSDGDAKLEQLAAKFKTPELAE
EFKQKFEECQRLLLDIPLQTPHKLVDTGRAAKLIQRAEEMKSGLKDFKTVLTNDQTKVTE
EESKNSDAGAVSVSDITTKPNPENTGPTVEWSNYDLREDALDDSVSSSSVHASPLASSPV
RKNLFRFGESTTGFNFSFKSALSPSKSPALLNQSGTTVGNDEESDVTQEEERDGQYFEPV
VPLPDLVEVSSGEENEQVVFSHRAKLYRYDKDVGQWKERGIGDIKILQNYDNKQVRIVMR
RDQVLKLCANHRITPDMTLQNMKGTERVWVWTACDFADGERKVEHLAVRFKLQDVADSFK
KIFDEAKIAQEKDSLITPHVSFSTTPRESPCGRIAVAVLEETTKERTDLLQGDDIADATS
EVGDVSSTSETTTKAVVSPPKFVFGSESVKSIFGSEKSKPFTFGNSSATGSLFGFSFNAP
LKNSETSSGVQSGSEREVEPNNCEESKNSDIKQSPDGKVQNLFAAFPKEEFSTNYTFKTP
EKAKEKIKPEDPPSDEDVLIVYELTPTPEHRALASKLKLPPTFFCYKNRPDYVSEEEEDD
EDFETAIKKLNGKLYLDDSEKYKPLEKSLTENEKECIIVWEKKPTVEEKAKADTLKLPPT
FFCGVGSDTDEDNGNGEDFQSELQKVQEAQKSHNEEITSTADSVCTGGTKVTVPFLCKSE
EPDFITKSICSSSIFSGTVDKPVDLSTRKDNDADSTSQVESKTISFGFGNNTGLSFADLA
SSNSGDFAFGSKDKNFQWANTGATVFGTQSTNKVGEEEDGSDEEVVYNEDIHFEPIVSLP
EVEVKSGEEDEEILFKERAKLYRWDRDVNQWKERGVGDIKILWHTLKNYYRILMRRDQVF
KVCANHVITKTMELKPLNVSNNALVWTASDYADGEAKVEQLAVRFKTKEMADCFKRKFEE
CQQNLLKLQKGQVSLTAELSKETNPVVFFDVCADDEPLGRITMELFSNIVPQTAENFRAL
CTGEKGFGFKNSIFHRVIPDFVCQGGDITKHDGTGGRSIYGDKFEDENFNVKHTGPGFLS
MANRGRDTNNSQFFITLKKAEHLDFKHVVFGFVKDGMDTVKKIESFGSPKGSVSRRISIK
ECGQI
Download sequence
Identical sequences G1P526
ENSMLUP00000005088 ENSMLUP00000005088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]