SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1P536 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1P536
Domain Number 1 Region: 12-227
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.23e-50
Family BAR domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1P536
Sequence length 250
Comment (tr|G1P536|G1P536_MYOLU) Bridging integrator 3 {ECO:0000313|Ensembl:ENSMLUP00000005100} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=BIN3 OC=Vespertilionidae; Myotis.
Sequence
IPFKIGQPKKQIVPKTVERDFEREYGKLQQLEEQTRKLQKDLKKSTDADLAMSKSAVKIS
LDLLSNPLCEQDQDFMNMVTALDTAMKRMDAFNQEKVNQIQKTVVEPLKKFGSVFPSLNM
AVKRREQALQDYRRLQAKVEKYEEKEKTGPVLAKLHQAREELRPVRDDFEAKNKQLLDEM
PRFYNSRLDYFQPSFESLIRAQVVYYSEMHKIFGDLTQQLDQPGHPDEQRERENEAKLSE
LRALSIVADD
Download sequence
Identical sequences G1P536
ENSMLUP00000005100 ENSMLUP00000005100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]