SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1P581 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1P581
Domain Number 1 Region: 58-165
Classification Level Classification E-value
Superfamily PH domain-like 4.3e-34
Family Pleckstrin-homology domain (PH domain) 0.00014
Further Details:      
 
Domain Number 2 Region: 4-82
Classification Level Classification E-value
Superfamily PDZ domain-like 6.84e-19
Family PDZ domain 0.00018
Further Details:      
 
Weak hits

Sequence:  G1P581
Domain Number - Region: 193-294
Classification Level Classification E-value
Superfamily PH domain-like 0.00291
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1P581
Sequence length 402
Comment (tr|G1P581|G1P581_MYOLU) Syntrophin alpha 1 {ECO:0000313|Ensembl:ENSMLUP00000005155} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=SNTA1 OC=Vespertilionidae; Myotis.
Sequence
GGRENKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQVLKKTGKEVV
LEVKYMKEVSPYFKNSASGTSVGWDSPPASPLQRQPSSPGPPPRDFNGAKHMSLKMAYIS
RRCTPSDPEPRYLEICSADGQDTLFLRATEEASARSWTAAIQAQINALMPWVKDELQALL
AATSTAGSQDIKQIGWLTEQLPNGGTAPTLALLTEKELLLYSCLPQTREALSRPAQTAPL
ITTRLVHSGPSKGSVPYDAELSFALRTGTRHGVDTHLFSVESPQELAAWTRQLVDGCHRA
AEGVQEVSTACTWNGRPCNLSVHIDKGFTLWAAEPGAAQAVLLRQPFEKLQMSSDDGASL
LFLDFGGAEGEIQLDLHSCPKTMVFIIHSFLSAKVTRLGLLA
Download sequence
Identical sequences G1P581
ENSMLUP00000005155 ENSMLUP00000005155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]