SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1P6D0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1P6D0
Domain Number 1 Region: 162-300
Classification Level Classification E-value
Superfamily Cadherin-like 4.57e-29
Family Cadherin 0.00053
Further Details:      
 
Domain Number 2 Region: 395-527
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-23
Family Cadherin 0.00054
Further Details:      
 
Domain Number 3 Region: 278-403
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000123
Family Cadherin 0.00037
Further Details:      
 
Domain Number 4 Region: 507-609
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000314
Family Cadherin 0.0024
Further Details:      
 
Domain Number 5 Region: 96-174
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000113
Family Cadherin 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1P6D0
Sequence length 747
Comment (tr|G1P6D0|G1P6D0_MYOLU) Cadherin 26 {ECO:0000313|Ensembl:ENSMLUP00000005622} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=CDH26 OC=Vespertilionidae; Myotis.
Sequence
ALRGGRRPSVCSLLIDVIFISKVSLINSLRQETEDLAKQTQHCHCISRRRATGLYGDVKR
RWVVTALELQLLPNPGPRPFLFSSFQLFNNMSVNMALMYLISGPGVDRYPEIGLFSIEDH
ENGKVYVHRPVDRETTPSFTVYFDVVNRLTGEYVDNSLIFNIRITDVNDHAPQFPENEFN
VSVRESHAAGQPVLQLLTVDLDEENTPNSRVLYFLVSQKPLLKESGFEIDRDSGEIRLLG
CLDYETAPRFTLLIRARDCGEPPLSATATVHISVQEGNNHRPTFIQENYKIQVPEGRVSP
DVLRLPVQDDDSPFTSAWRAKFNISNGNEEGHFDISTDPETNEGILNVIKALDYETHPAC
SLVIAVENEELLVPCEAGELQKPRRKTAVSAMVLVQVTDANDPPAFHPRSFVVSEVEGAR
PGTRLGRFNATDPDGSGSQIRYELAHDPASWVTVDERSGVVVTRRRLDRESPHVNNGVYV
VIAHAVDEGHPPQTGTGTLMLLLSDINANAPSLHPHSRYLEVCESSEPEPLLIEAEDGDL
EPSSDPFTFELDTTGHARVTWKLGENRGRSVELLMLRSLPPGDYSVPLSIGDGQGLSQKQ
TVHVRVCSCPGGATCAAEPLAAGPELPVGVLAPLCVVFLALAVALLLLLRCDCVSGAKRH
RCPALHQEGQQTLITYNDESRAIAGQVGSEVRNQKPALPTHIAEEGALLGAKDTNEVLPP
PAHASDQAHFVLRLQCVTEVHSLLWSP
Download sequence
Identical sequences G1P6D0
ENSMLUP00000005622 ENSMLUP00000005622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]