SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1P6M6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1P6M6
Domain Number 1 Region: 326-653
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.2e-89
Family Protein kinases, catalytic subunit 0.0000000866
Further Details:      
 
Domain Number 2 Region: 96-181
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.35e-20
Family PB1 domain 0.0000176
Further Details:      
 
Domain Number 3 Region: 197-267
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.64e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1P6M6
Sequence length 671
Comment (tr|G1P6M6|G1P6M6_MYOLU) Protein kinase C {ECO:0000256|SAAS:SAAS00929532} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN= OC=Vespertilionidae; Myotis.
Sequence
CWVPRRGRGGGGRGRWEEPRGSGCPGEATLGSAPRAGAQGEERRAAAPGRLRQPSPPARP
QPPRPPASRRGSQEMPTQRDSTTMSHPIAGGGFGDHAHQVRVKAYYRGDIMITHFEPSIS
FEGLCNEVRDMCSFDNEQLFTMKWIDEEGEWCTKNSDLQLPEVWALEQLTKISEFKILLF
PCVPERPGMPCPGEDKSIYRRGARRWRKLYCANGHTFQAKRFNRRAHCAICTDRIWGLGR
QGYKCINCKLLVHKKCHKLVTIECGRHSLPPEPMMPMDPSSMHSDHAQTVIPYNPSSHES
LDQVGEEKEAMNSRESGKASSSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVK
KELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQR
QRKLPEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKKEGLR
PGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQN
TEDYLFQVILEKQIRIPRSLSVKAASVLKSFLNKDPKERLGCHPQTGFADIQGHPFFRNV
DWDMMEQKQVVPPFKPNISGEFGLDNFDSQFTNEPVQLTPDDDDIVRKIDQSEFEGFEYI
NPLLMSAEECV
Download sequence
Identical sequences G1P6M6
ENSMLUP00000005728 ENSMLUP00000005728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]