SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1P723 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1P723
Domain Number 1 Region: 439-549
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-30
Family SH2 domain 0.00000103
Further Details:      
 
Domain Number 2 Region: 119-213
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-24
Family Ras-binding domain, RBD 0.00022
Further Details:      
 
Domain Number 3 Region: 240-368
Classification Level Classification E-value
Superfamily PH domain-like 8.22e-16
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1P723
Sequence length 552
Comment (tr|G1P723|G1P723_MYOLU) Growth factor receptor bound protein 10 {ECO:0000313|Ensembl:ENSMLUP00000005893} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=GRB10 OC=Vespertilionidae; Myotis.
Sequence
ENDIDLEGLVNDMNTSLESLCPSSNMQSETVPLRQNGQHTRGQPPPAGARPAEPQASAQQ
KVQRSQPMHILAVRRLQEEDQQLKTSSLPAIPNPFPELGKKPLQSVPTPPFLLPSRWPAR
SLQKQDVKIFGEDGTCKVVEIPVDMKSRDLCQLLVYRSHCVDDNSWTLVEFHPHLGIERC
LEDHELVAQVDSTMAGESKFLFRKNYGKYEFFKNPTNFFPDQMVTWCQQSNGGQNQLLQN
FLNTSSCPEIQGFLHVKELGRKSWKKMYLCLRRSGLYCSTKGSSKEPRHLQLLADLDDCS
VFSVISGKKQYHTPTEFGFCLKPNKVLQETKELRVLCAEDEQGRICWMTAFRLLKYGMTL
YQNYRLPHHRKAAYLSSLSGPVRSVSESSLVAMDFSGQTGRVIDNPDEAESAALEEGHAW
RRRSTRMSALGSQSPLAHSSLNTVIHKSQHWFHGRISREESHRIIKQQGLVDGLFLVRDS
QSNPKAYVLTLSHHQKIKNFQILPCEEEGQVFFSLDDGNTKFSDLIQLVDFYQLNKGVLP
CKLKHHCVRVAL
Download sequence
Identical sequences G1P723
ENSMLUP00000005893 ENSMLUP00000005893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]