SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1P7M3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1P7M3
Domain Number 1 Region: 265-528
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.07e-79
Family STAT DNA-binding domain 0.0003
Further Details:      
 
Domain Number 2 Region: 529-648
Classification Level Classification E-value
Superfamily SH2 domain 1.24e-35
Family SH2 domain 0.00024
Further Details:      
 
Domain Number 3 Region: 112-273
Classification Level Classification E-value
Superfamily STAT 5.89e-27
Family STAT 0.0035
Further Details:      
 
Domain Number 4 Region: 1-115
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 4.05e-26
Family Transcription factor STAT-4 N-domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1P7M3
Sequence length 846
Comment (tr|G1P7M3|G1P7M3_MYOLU) Signal transducer and activator of transcription {ECO:0000256|RuleBase:RU046415} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=STAT6 OC=Vespertilionidae; Myotis.
Sequence
MSLWGLVSQIPPEKLQRLYVDFPQHLRHLLGDWLEKQPWEFLVGSDAFCCNMASTLLSAT
VQHLQASARKQGEGSAILQHISTLESIYQRDPLKLVATFRQILQGEKKAVMEQFRHLPMS
FHWKQEELKFSTALQRLRHRVGETCLLREALKQEAEAGQVSLHSLIEAPANGTGPSEALA
TLLQETVGELEAAQALVLKRIQIWKRQQQLAGNGAPFDENLTQLQERCESLVDIYSQLQQ
EVGAAGGELEPKTRAALINRLDEVLRTLVTSSFLVEKQPPQVLKTQTKFQAGVRFLLGLR
FLGASAKFPLVRADMVTEKQARELSNPQGPGAGVESSGEITNNTVPFENIGSGNCCSALF
KNLLLKKIKRCERKGTESVTEEKCAVLFTTSFILGPNKLPIQLQALSLPLVVIVHGNQDN
NAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTNQGLLPEHFLFLAQK
IFNDNSLSIETFQHRSVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLKSYWSDRLIIG
FISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIR
SLGDRIRDLAQLKNLYPKKPKDEAFRSHYKHEQIGKDGRGYVPATIKMTVERDQPLPTPE
AHMSTMLPTYDLRMAPDPMNMQLSPDMGPQVYPPHSHSIPSYQVLSQEESVNVLPAFPEP
HLQMSPSLDQMSLPFDQSHPQGLLLCQPQEHAMSSPEHLLCSDVTMAEESCRSQPVGGFS
QPTWVGEDMFPPLLPPTEQDLTNLLLEGQGESAGGPLGAQPLLQPNPYGQSGISMSHMDL
RANPSW
Download sequence
Identical sequences G1P7M3
ENSMLUP00000006128 ENSMLUP00000006128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]