SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1P813 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1P813
Domain Number 1 Region: 257-564
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.19e-88
Family Protein kinases, catalytic subunit 0.0000000199
Further Details:      
 
Domain Number 2 Region: 93-201
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.41e-34
Family Synaptotagmin-like (S variant) 0.00000494
Further Details:      
 
Domain Number 3 Region: 17-73
Classification Level Classification E-value
Superfamily Cysteine-rich domain 9.27e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1P813
Sequence length 595
Comment (tr|G1P813|G1P813_MYOLU) Protein kinase C {ECO:0000256|SAAS:SAAS00929532} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=PRKCB OC=Vespertilionidae; Myotis.
Sequence
TTSGPGSSEGPDRREDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHK
RCVMDVSSLCGTGHTERRGRIYIRAHIEGDKRHIRVRDAKNLVPMDPNGLSDPYVKLKLI
PDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSF
GISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGGEGNEELRQKFERAKIGQTPKTPEEKT
TNTIAKFDNNGNRDRMKLSDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQD
DDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEP
HAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTF
CGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYP
KSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKA
CGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFSFVNSEFLKPEVKSMAI
Download sequence
Identical sequences G1P813
ENSMLUP00000006287 ENSMLUP00000006287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]