SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1P881 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1P881
Domain Number 1 Region: 402-739
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.02e-96
Family Oxysterol-binding protein 0.0012
Further Details:      
 
Domain Number 2 Region: 70-158
Classification Level Classification E-value
Superfamily PH domain-like 3.6e-23
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Weak hits

Sequence:  G1P881
Domain Number - Region: 255-303
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0916
Family DNA-binding N-terminal domain of transcription activators 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1P881
Sequence length 739
Comment (tr|G1P881|G1P881_MYOLU) Oxysterol-binding protein {ECO:0000256|RuleBase:RU003845} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=OSBP2 OC=Vespertilionidae; Myotis.
Sequence
PKASSGRPPGPVVGSVPSIRPASGSQPASKPPALPRPGQLRVSYGVPLAGAGTASTAPKA
LLPLLPLDSFKGWLLKWTNYLKGYQRRWFVLSNGLLSYYRNEGEMAHTCRGTINMSTAHF
DREDYCSIVLTSGAKTYHLKASSDVERQQWITALELAKAKAVRMMRSHSDDSGDDDDETA
APADKTELQSTIKNLSLKLDDLSTCHDLLAKHGAALLRSLNELDSLRIPYDSSEKLKAVN
ERATLFRITSNAMINACKDFLALAEAHSRKWQRALQYEQEQRIHLEETIEQLAKQHNSLE
RAFRNSLPGRSSDPNKNFSQESLLTSKEEDSEEDEDSEYFDAMEDSTAFITVITEAKDDR
KTEGGTTGPVDWTPADNVQDGASLTPKGPPKVKRRVRIPDKPNYSLNLWSIMKNCIGREL
SKIPMPVNFNEPLSMLQRLTEDLEYHHLLDKAVHCTSSVEQMCLVAAFSVSSYSTTVHRI
AKPFNPMLGETFELDRLEDMGLRSLCEQVSHHPPSAAHHVFSRNGWSLWQEITISSKFRG
KYLSIMPLGAIHLEFQASGNHYVWRKSTSTVHNIIVGKLWIDQTGDIEIVNHKTKDRCQL
KFLPYSYFSKEVARKVTGVVSDGQGKAHYVLSGSWDEQMEYAKIMQSSSGSPSVDGKHKT
VYQTLPAKLLWKKYPLPENAENMYYFSELALTLNEHEEGVAPTDSRLRPDQRLMEKPDQR
LMEKGQLDEANTEKQRLEE
Download sequence
Identical sequences G1P881
ENSMLUP00000006369 ENSMLUP00000006369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]