SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1P8J4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1P8J4
Domain Number 1 Region: 6-291
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.62e-77
Family BAR domain 0.0051
Further Details:      
 
Domain Number 2 Region: 265-344
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000107
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1P8J4
Sequence length 345
Comment (tr|G1P8J4|G1P8J4_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000006501} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN= OC=Vespertilionidae; Myotis.
Sequence
MGLPALEFSDCCLDSPHFRETLKSHEAELDKTNKFIKELIKDGKSLISALKNLSSAKRKF
ADSLNEFKFQCIGDAETDDEMCIARSLQEFASVLRNLEDERIRMIENASDVLITPLEKFR
KEQIGAAKEAKKKYDKETEKYCGILEKHLNLSSKKKESQLQEADSQVDLVRQHFYEVSLE
YVFKVQEVQERKMFEFVEPLLAFLQGLFTFYHHGYELAKDFSDFKMQLTISIQNTRNRFE
GTRSEVESLMKKMKENPLEHKTISPYTMEGYLYVQEKRECHFGTSWVKHYCTYQRDSKQI
TMVPFDQKSGGKGGEDESVTLKSCIRRKTDSIEKRFCFDVEAVDR
Download sequence
Identical sequences G1P8J4
ENSMLUP00000006501 ENSMLUP00000006501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]