SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1P905 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1P905
Domain Number 1 Region: 6-155
Classification Level Classification E-value
Superfamily ENTH/VHS domain 1.45e-40
Family VHS domain 0.0000357
Further Details:      
 
Domain Number 2 Region: 168-290
Classification Level Classification E-value
Superfamily GAT-like domain 2.3e-27
Family GAT domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1P905
Sequence length 476
Comment (tr|G1P905|G1P905_MYOLU) Target of myb1 like 1 membrane trafficking protein {ECO:0000313|Ensembl:ENSMLUP00000006681} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=TOM1L1 OC=Vespertilionidae; Myotis.
Sequence
MAFGKSHRDPFATSVGHLIEKATFAGVQTEDWGQFLHICDIINTASDGPKDAVKALKKRI
SKNYNHKEIELTLSLIDMCMQNCGPSFQSLIVKKEFVKDSLVKLLQPRYTLPLNIQNRIL
NFIKTWSQGFPGGVDVSEVKDVYLDLLKKGVHFPPSEAEVEAAEQETAQVSSNPPTSVPT
APALSSVIAPKNATITLVPEQIGKLHSELDMVKMNVKVMSAILMENIPGSENPEDMELLQ
KLYKTGREMQDRIMDLLVVVENEDVTIELIQVNEDLNNAILGYERFTRNQQRILEQNNQR
EDTNAATEPSAPSCDLLDLSPSTPNHRATLEEVNAMNAQLSHLSFSSPTPVIMNSLQPSP
RPQMDLLALENTDTAMFAQRTSQNPDSSHTYESLPVYQNSVLLQPESLHTVPASPSNQTL
PALPANHPAMTKNDLQLPNYYEVMEFDPLAPAVTTEAIYEEIDVHHRKGTQNHSDC
Download sequence
Identical sequences G1P905
ENSMLUP00000006681 XP_006095637.1.53796 ENSMLUP00000006681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]