SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1P9E5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1P9E5
Domain Number 1 Region: 2-206
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-48
Family DBL homology domain (DH-domain) 0.00014
Further Details:      
 
Domain Number 2 Region: 509-744
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000139
Family Cell cycle arrest protein BUB3 0.09
Further Details:      
 
Weak hits

Sequence:  G1P9E5
Domain Number - Region: 222-296,383-435
Classification Level Classification E-value
Superfamily PH domain-like 0.0148
Family Pleckstrin-homology domain (PH domain) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1P9E5
Sequence length 770
Comment (tr|G1P9E5|G1P9E5_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000006844} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=ARHGEF10 OC=Vespertilionidae; Myotis.
Sequence
VVRRYILGSIVDSEKNYVDALTRILEQYERPLAEMEPRVLSERKLRVVFHRLREVRQCHR
LFQMALASRVAEWDAVEMIGDVFVASFSKSMVLDAYSEYVNNFSAAVAVLKKACSTKPAF
LEFLKQSQESSPDRVTLYSLMTRPIQRFPQFILLLQDMLRNTPRGHPDRLPLQMALTELE
TLAEKLNERKRDADQRCEMKQLAKAINERYLNKLLSSGSRHLIRSDDVIETVYNDRGEVL
KTKERRLLMLTDVLMCVTVSARTGPDSHALLPASQRHLLKWSVPLGHVAVVEYGHPEGAA
EHPPESLAVVANAKPHRVHVGPGQLYQDLQNLLHDLNVVGQIAQLVGDLRGHYQNLNQAV
AHDWASGLQRLVLRKEEEIRAADCCRLQLQLPGKQDKSGRPTFFTAVFSTFTPACKESWL
SSLQMAKLALEEDNHVGWFCVEDDGNQVKKDRHPLLLGHMPVTVAKQQEFKIECAVYNPE
PHPGRAGRPDPTGAAQGFLWIGSCTGQMGQIAIVSFHNSNPKVIECFNVESRILCMVHMP
AERGPQPSPAPEPGTTAGSALGIPTVCLGTEEGSISVYKSSPGAKKVRLQQFFTPDKATV
MSLACTPRNLYAGLVDGAVAVYAKAQDGSWDSEPHKVIKLGVLPVRSLLTAEDTLWAASG
GQVSIVSVETHAVGSQLEAHQEEGMVVSHMAIAGVGIWIAFTSGSTLRLFHTETLKHLQD
INIATPVHHMLPGNRAGPSAVRTSLLVCHDLLMSAPALGFVEALPIPRLQ
Download sequence
Identical sequences G1P9E5
ENSMLUP00000006844 ENSMLUP00000006844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]