SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1P9V2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1P9V2
Domain Number 1 Region: 253-523
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.19e-79
Family Protein kinases, catalytic subunit 0.0000000116
Further Details:      
 
Domain Number 2 Region: 118-246
Classification Level Classification E-value
Superfamily SH2 domain 1.57e-34
Family SH2 domain 0.0000358
Further Details:      
 
Domain Number 3 Region: 73-142
Classification Level Classification E-value
Superfamily SH3-domain 1.34e-17
Family SH3-domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1P9V2
Sequence length 527
Comment (tr|G1P9V2|G1P9V2_MYOLU) Tyrosine-protein kinase {ECO:0000256|RuleBase:RU362096} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=TXK OC=Vespertilionidae; Myotis.
Sequence
MLCFSDNTIQSIFCCCCCCSVQKRQVRTQISLSNDEELSEKYIQPRRQWFSELRSKKQSN
RGRVQPSKRKPLPPLPPPEVAEEKTRVMALYDFLPREPCDLALKRAEEYLILEKHDTHWW
KARDRWGNEGFIPSNYVAENKLTNLEIYEWYHRNITRNQAERLLRQESKEGAFIVRDSRH
LGSYTISVFTRDRRSMEPTIKHYQIKKNDSGEWYVAERHLFQSIPDLIWYHQHNAAGLMS
RLRYPVGLMGSCLPATAGFSYEKWEIDPSELAFVKEIGSGQFGVVHLGEWRAHFQVAIKA
INEGSMSEEDFIEEAKVMTKLSHSRLVQLYGVCIQQKPLYIVTEFMENGCLLDYLRERKG
KLRKEMLLSMCQDICEGMEYLERNCFIHRDLAARNCLVSSTSIVKISDFGMTRYVLDDEY
ISSSGAKFPVKWSPPEVFHFNKYSSKSDVWSFGVLMWEVFTEGRMPFENKSNLQVVEAIS
KGFRLYRPRLAPMSIYEVMYHCWHEKPKGRPTFAELLRVLSEIAETW
Download sequence
Identical sequences G1P9V2
ENSMLUP00000007028 XP_006101335.1.53796 ENSMLUP00000007028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]