SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PAS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PAS1
Domain Number 1 Region: 734-980
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.21e-62
Family Nuclear receptor ligand-binding domain 0.0000000664
Further Details:      
 
Domain Number 2 Region: 598-676
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.05e-27
Family Nuclear receptor 0.0000222
Further Details:      
 
Weak hits

Sequence:  G1PAS1
Domain Number - Region: 692-699
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0575
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1PAS1
Sequence length 982
Comment (tr|G1PAS1|G1PAS1_MYOLU) Nuclear receptor subfamily 3 group C member 2 {ECO:0000313|Ensembl:ENSMLUP00000007404} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=NR3C2 OC=Vespertilionidae; Myotis.
Sequence
METKGYHSLPEGLDMERRWGQVSQAVDHSSLGPTERTDENNYMEIVNVSCVSGAIPNNST
QGSSKEKHELLPCLQQDNNRSGILTSDIKTELESKELSVTVAESMGLYMDSIRDAEYTYD
PQNQQGSLSPAKIYQNVEQLVKFYKENGHCPSTAGMSRPLRSFMADSGSSVNGGVMRAIV
KSPLLCHEKSSSVCSPLNMTSSACSPAGLSSVSSTSASFGNFTVHSPITQGTPLTCSPNI
ETRGSRSHSPAHASNVGSPLSSPLSSMKSPVSSPPSHCSVKSPVSSPNVTLRSAVSSPAN
INNSRCSVSSPSNTNNRSTLSSPTASTVGSICSPVSNAFSYTASGTPLGSSAARDLVSSP
DTQEKGAHEVSFPKIEEAENATSNGVTGQLNIVQYIKPEPDGVFSSSCLRGNSKMNPASP
FSVPIKQESTKHSCSGTSFKGNPTVNPFPFMDSSYFSFMDDKDYYSLSGILGPPVPGFDG
SCEGSGFPVGIKQEPDDGSYYPEASIPSSAIVGVNSGGQSFHYRIGAQGTISLSRAARDQ
SFQHLSSFPPVNTLVESWKSHSDLASRRSDGYPVLEYIPENVSSSTLRSVSTGSSRPSKI
CLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRLQK
CLQAGMNLGARKSKKLGKLKGIHEEQSQQQQPPPPPPPPQSPEEGTTYIAPAKEPSVNTA
LVPQLSTISRALTPSPGMILETIEPEIVYAGYDGSKPDTAEGLLSTLNRLAGKQMIQVVK
WAKVIPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQ
SAMYELCQGMHQVSLQFVRLQLTFEEYTIMKVLLLLSTVPKDGLKSQAAFEEMRTNYIKE
LRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESQALKVEFPAMLVE
IISDQLPKVESGNAKPLYFHRK
Download sequence
Identical sequences G1PAS1
ENSMLUP00000007404 XP_006081825.1.53796 ENSMLUP00000007404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]