SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PBE8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PBE8
Domain Number 1 Region: 66-279
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.38e-54
Family Ankyrin repeat 0.00014
Further Details:      
 
Domain Number 2 Region: 287-328
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000615
Family SOCS box-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1PBE8
Sequence length 329
Comment (tr|G1PBE8|G1PBE8_MYOLU) Ankyrin repeat and SOCS box containing 5 {ECO:0000313|Ensembl:ENSMLUP00000007673} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=ASB5 OC=Vespertilionidae; Myotis.
Sequence
MSALEDGRPFAQQLSNVYFTILSLFCFKLFVKISLAILSHFYIVKGNRKEAARIAAEFYG
AAPGQGSWADRSPLHEAASQGRLLALQTLLSQGYNVNAVTIDHVTPLHEACLGDHVACAR
TLLEAGANVNAITIDGVTPLFNACSQGSPCCAELLLEYGAKPQLESCLPSPTHEAASKGH
HECLQILISWGIDVDQDIPHLGTPLYVACMSQQFHCIRKLLYAGADVQKGKYWDTPLHAA
AQQSNTEIVHLLLEFGADINAKNTELLRPVDVASSSSLVERMLLQHEATPSSLCQLCRLC
IRRRIGRPRLHLIPQLQLPTLLQNFLQYR
Download sequence
Identical sequences G1PBE8
ENSMLUP00000007673 ENSMLUP00000007673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]