SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PBJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G1PBJ7
Domain Number - Region: 57-138
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0837
Family IMD domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1PBJ7
Sequence length 206
Comment (tr|G1PBJ7|G1PBJ7_MYOLU) Polyamine modulated factor 1 {ECO:0000313|Ensembl:ENSMLUP00000007735} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=PMF1 OC=Vespertilionidae; Myotis.
Sequence
MAEASNASVGSGCEEKGREGSSPEPVSPDTTISRMKLLDTTVDTFLQKLVAAGSYQRFTD
CYKRFYQLQPEMTQRIYDKFLTQLQTSIREEISEIKAEGNLEAVLTALDTIVEEGKDRKE
PAWRPSGIPEKDLRSTMVPYFLQQRDALRRRVQRQEAENRQLADAVLAGRRQVEELQLQG
QAQWQAWQMAGSAQRTEGAGGHAEGA
Download sequence
Identical sequences G1PBJ7
ENSMLUP00000007735 ENSMLUP00000007735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]