SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PBM8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PBM8
Domain Number 1 Region: 768-837
Classification Level Classification E-value
Superfamily TB module/8-cys domain 6.93e-21
Family TB module/8-cys domain 0.0000687
Further Details:      
 
Domain Number 2 Region: 272-335
Classification Level Classification E-value
Superfamily TB module/8-cys domain 8.24e-18
Family TB module/8-cys domain 0.00046
Further Details:      
 
Domain Number 3 Region: 646-767
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.46e-16
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 4 Region: 828-980
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000895
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 5 Region: 990-1041
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000196
Family TB module/8-cys domain 0.0019
Further Details:      
 
Domain Number 6 Region: 601-647
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000152
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 7 Region: 1108-1158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000402
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 8 Region: 162-214
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000445
Family TB module/8-cys domain 0.0032
Further Details:      
 
Domain Number 9 Region: 1077-1122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000998
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 10 Region: 4-32
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000275
Family EGF-type module 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1PBM8
Sequence length 1166
Comment (tr|G1PBM8|G1PBM8_MYOLU) Latent transforming growth factor beta binding protein 3 {ECO:0000313|Ensembl:ENSMLUP00000007778} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=LTBP3 OC=Vespertilionidae; Myotis.
Sequence
VVCPLPCMNGGQCSSRNQCLCPPDFTGRFCQVPAGGAGGGTGGSGPGLGRAGALSTGALP
PLAPESESVASKHIYAVQVIADPPGPGEGPPAQHAAFLVPLGPGQISAEVQAPPPVVNVR
VHHPPEASVQVHRIEGLNAEGPGPSQHLLPHPKPQHPRPPTQKPLGRCFQDTLPKQPCGS
NPLPGLTKQEDCCGSIGTAWGQSKCHKCPQLQCECRAQAWGPHTLLLPPRPEGEARVKKR
INNLLNAEIQVCVCPPGHSLGPSRTQCIADKPEEKSLCFRLVSPEHQCQHPLTTRLTRQL
CCCSVGKAWGARCQRCPADGTAAFKEICPAGKGYHILTSHQTLTIQGESDFSLFLHPDGP
PKPQQLPESPSRGPPPENTEEERGVSTDSPGVEEQSAQQSHPTATTSPARPYPELISRPS
PSTVRWFLPDLPPLEIAPTQVTVNLELEHVSGASCAPGLGDPSECSRDPTLPYNDLGIMI
SPVCLSHKCLKQIINQRRRKESGGCDNRERGNERRRTWSLAKRLGFDPKGCGKCLQGFGH
TGSCQPDWNLEARFAPGCPGGLHCLGQPSDSPGDCGSVFGVGQSSASRPGLHGDGGGEEA
DVNECAEGSPCSPGWCENLPGSFRCTCAQGYAPAPDGRSCLDVDECESGDVCDNGICTNT
PGSFQCQCLSGYHLSRDRSRCEDIDECDFPAACIGGDCINTNGSYRCLCPQGHRLVGGRK
CQDIDECSQDPGLCLPHGACENLQGSYVCVCDEGFTPTQDQHGCEEVEQPHHKKECYLNF
DDTVFCDSVLATNVTQQECCCSLGAGWGDHCEIYPCPVYSSAEFHSLCPDGKGYTQDNNI
VNYGIPAHRDIDECILFGAEICKEGKCVNTQPGYECYCKQGFYYDGNLLECVDVDECLDE
SNCRNGVCENTRGGYRCACTPPAEYSPAQRQCLSPEEMDVDECQDPAACHPGRCVNLPGS
YRCECRPPWVPGPFGRDCQLPESPAERAPEQRDVCWAQRGEDGMCARPLAGPTLTFEDCC
CRQGRGWGAQCRPCPPRGAGSQCPTSQSESNSFWDASPLLLGKPPRGCAEEDSSEEDSDE
CRCVSGRCVLRPGGAVCECPGGFQLDASRARCVDIDECRELNQRGLLCKSERCVNTSGSF
RCVCKPGYARIRPHGACVSQRPQRRR
Download sequence
Identical sequences G1PBM8
ENSMLUP00000007778 ENSMLUP00000007778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]