SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PC16 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PC16
Domain Number 1 Region: 1507-1611
Classification Level Classification E-value
Superfamily Bromodomain 3.01e-32
Family Bromodomain 0.00000151
Further Details:      
 
Domain Number 2 Region: 1356-1485
Classification Level Classification E-value
Superfamily Bromodomain 6.93e-31
Family Bromodomain 0.000000228
Further Details:      
 
Domain Number 3 Region: 23-79
Classification Level Classification E-value
Superfamily TAF(II)230 TBP-binding fragment 8.89e-17
Family TAF(II)230 TBP-binding fragment 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1PC16
Sequence length 1865
Comment (tr|G1PC16|G1PC16_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000007938} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN= OC=Vespertilionidae; Myotis.
Sequence
IQPGCPAGATAAIMSDTDSNEDSTGGCPFSLTGFLFGNISAAGQLEGESVLDDECKKHLE
GLGALGLGSLITELTENEELNGNDDALVNDEGWIRSTEDAVDYSDISEVAEDESRRYQHT
MGSLQPLCHSEYDDDDYDADCEDIDCKLMPPPPPPPGPLKKDKDQDALASEKVEFRSSSD
SESEMGPQEATQAESEDGKLTLPLGGIMQHDATKLLPNVTELFPEFRPGKVLRFLRLFGP
GKNVPSVWRSARRKRKRKHRELIQEEQIQEVECSVESEVNQKSLWTYDYAPPPPPEQCLS
DDEITMMAPVESKFSQSTGDIDKVTDTKPRAAEWRYGPARLWYDMLGVPEDGSGFDYGFK
LRKMEHEPVVKGRVIEDFRKFEESSGTDLLADENFLMATQQHWEDDIIWDGEDVKHKGTK
PQRASLAGWLPSSMTRNARAYNVQQGCAATRDDDKPWYSIFPIDNEELVYGRWEDNIIWD
AEAMPRLLEPPVLTLDPNDENLILEIPDEKEEATSNSPSKESKKESSLKKSQILLGKTGI
IKEEPQQNMSQPEVKDPWNLSNDEYYYPKQQGLRGTFGGNIIQHSIPAVELRQPFFPTHM
GPIKLRQFHRPALKKYSFGALSQPGPHSVQPLLKHIKKKAKMREQERQASGGGEMFFMRT
SQDLTGKDGDLILAEYSEENGPLMMQVGMATKIKNYYKRKPGKDPGAPDCKYGETVYCHT
SPFLGSLHPGQLLQAFENNLFRAPIYLHKMPDTDFLIIRTRQGYYIRELVDIFVVGQQCP
LFEVPGPNSKRANTHIRDFLQVFIYRLFWKSADRPRRIRMEDIKKAFPSHSESSLRKRLK
LCADFKRTGMDSNWWVLKPDFRLPTEEEIRAMVSPEQCCAYYSMRAAEQRLKDAGYGEKS
FFAPEEENEEDFQVKIDDEVRTAPWNTTRSFISAMKGKCLLEVTGVADPTGCGEGFSYVK
IPNKPTQQKDDKEPQPVKKTVTGTDADLRRLSLKNAKQLLRKFGVPEEEIKKLSRWEVID
VVRTMSTEQARSGEGPMSKFARGSRFSVAEHQERYKEECQRIFDLQNKVLSSTEVLSTDT
DISSTEDSDFEEMGKALENMLQNKKTSSQLSHEREEQERKELQRMLLAAGSAAAGNNHRD
DDDTASVTSLNSSATGRCLKIYRTFRDEEGKEYVRCEMVRNPAVIDAYVRIRTTKDEEFI
RKFALFDDQHREEMRKERRRIQGQLRRLKRNQEKEKLKGPPEKKPKGLKEHPDLKLKCGA
CGAIGHMKTNKFCPLYYQTSAPPSNPVAMTEEQEEELEKTAIHNDNEELIKVEGTKIVLG
KQLMESADEVRRKSLVLKFPKQQLPPKKRQRVGNTVHCDYLNRPHKSIHRRWTDPMVTMS
SILESIINDMRDLPNTYPFHTPVNGKVVKDYYKIITRPMDLQTLRENVRKHLYPSREEFR
EHLELIVKNSTTYNGPKHSLTQISQSMLDLCDEKLKEKEDILARLEKAINPLLDDDDQVT
FSFILDNIVTQKMMAVPDSWPFHHPVNKKIVPDYYEVIVSPMDLETIRKNISKQKYQSRK
SFLDDVNLILANSVKFNGPESQYTKTAQEIVNVCCQALTEFNEHLTQLEKDICTAKEATL
EEAELDSLDPMTPGPYTPQPPGLYDTNTSLSMSRDASVFQDESNMSVLDIPTTTPEKQVT
QEGEGADGDLADKEEGTVQQPQASVLYEDLLMSEGEDDEEDAGSDEEGDNPFSAIQQSER
GSDSDVASGGIIPKQPRMLQENTRMGMENEESMMSYEGDGGAGSHGLEDSNISYGSYEEP
DPKSNTQDTSFSSIGGYEVSEEEEDEEEEQRSGPSVLCQVHLSEDEEDSEDFHSISGDSD
LDSDE
Download sequence
Identical sequences G1PC16
ENSMLUP00000007938 ENSMLUP00000007938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]