SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PC51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PC51
Domain Number 1 Region: 156-294
Classification Level Classification E-value
Superfamily SH2 domain 5.12e-27
Family SH2 domain 0.00039
Further Details:      
 
Domain Number 2 Region: 40-94
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-21
Family SH3-domain 0.00077
Further Details:      
 
Domain Number 3 Region: 121-203
Classification Level Classification E-value
Superfamily SH3-domain 6.69e-21
Family SH3-domain 0.0000285
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1PC51
Sequence length 304
Comment (tr|G1PC51|G1PC51_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000007981} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=NCK2 OC=Vespertilionidae; Myotis.
Sequence
GLGKTKRKTSARDASPTPSTDAEYPANGGADRIYDLNIPAFVKFAYVAEREDELSLVKGS
RVTVMEKCSDGWWRGSYNGQIGWFPSNYVLEEVDEAAAESPSFPSLRRGAPVSNGQGARV
LHVVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNARGQVGLVPKNYVVVLS
DGPVLPPSHVPQISYPGPAGSGRFAGREWYYGNVTRHQAECALNERGREGDFLIRDSESS
PSDFSVSLKASGKNKHFKVQLVDSVYCIGQRRFHTMDELVEHYKKAPIFTSERGEKLYLV
RALQ
Download sequence
Identical sequences G1PC51
ENSMLUP00000007981 ENSMLUP00000007981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]