SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PC97 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PC97
Domain Number 1 Region: 193-352
Classification Level Classification E-value
Superfamily SET domain 5.23e-40
Family Histone lysine methyltransferases 0.0000000388
Further Details:      
 
Domain Number 2 Region: 70-161
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 2.88e-21
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.000002
Further Details:      
 
Domain Number 3 Region: 18-68
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0000000000119
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1PC97
Sequence length 365
Comment (tr|G1PC97|G1PC97_MYOLU) Histone-lysine N-methyltransferase {ECO:0000256|PROSITE-ProRule:PRU00910} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=SETD7 OC=Vespertilionidae; Myotis.
Sequence
MDSDDEMVEEAVEGHLDDDGLPHGFCTVTYSSTDRFEGNFVHGEKNGRGKFFFFDGSTLE
GYYVDDALQQGVYTYEDGGVLQGTYVDGELNGLAQEYDTDGRLIFKGQYKDNIRHGLCWI
YFPDGGSLVGEVNEDGEMTGEKIAYVYPDKRTALYGKFIDGEMLEGKLAALVSTEEGRPH
FDLMPGSSVYHFDKSTSSCISTNALLPDPYESERVYVAESLISSAGEGLFSKVAVGPNTV
MSFYNGVRITHQEVDSRDWALNGNTLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFTP
NCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAPEWYQVELKAFQ
ATQQK
Download sequence
Identical sequences G1PC97
ENSMLUP00000008030 ENSMLUP00000008030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]