SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PCJ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PCJ1
Domain Number 1 Region: 119-233
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-21
Family Cadherin 0.00021
Further Details:      
 
Domain Number 2 Region: 442-559
Classification Level Classification E-value
Superfamily Cadherin-like 8.42e-16
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 358-441
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000012
Family Cadherin 0.0013
Further Details:      
 
Domain Number 4 Region: 33-125
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000314
Family Cadherin 0.0024
Further Details:      
 
Domain Number 5 Region: 258-319
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000957
Family Cadherin 0.0026
Further Details:      
 
Weak hits

Sequence:  G1PCJ1
Domain Number - Region: 556-594
Classification Level Classification E-value
Superfamily Cadherin-like 0.000157
Family Cadherin 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1PCJ1
Sequence length 598
Comment (tr|G1PCJ1|G1PCJ1_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000008132} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN= OC=Vespertilionidae; Myotis.
Sequence
MARAQLHCLCLLTLYLTTGRGQEGKFSGPLKPMTFSIFEGQEPSQIIFQFKASPPAVTFK
LTGETDGIFEIQPDGLLYHNRALDRETRAVHKLQVSALDAQGNTVEGPVPITVEVKDIND
NRPTFLQSKYEGSVRQNSRAGKPFMYVNATDLDDPDTPNGQLFYQIVMQLPKVNDVMYFQ
INNKTGAISLTLAGSKELDPSKNPFYSLVVSVKDMGGQTENSFSDSTSVDITVKENIWKA
PEPVEIVENSTDPHPIKITQVRWNEPGAHYSLVEKERLPRFPFSIDQEGDIYVTQPLDRE
EKDSYVFYAFAKDELGKPLLFPPESYEAQVLTTSTQGQTCATKVSICQQMPTDKGVSSIG
TLVAHDMDEENTVNSVLHYKIVDQFPKFPKDGLFLIQSYTGVFQLAMQSLKKQDASQYLL
TVEVSDKDFQTLCQVKINVIDINDQIPIFEKSDYGNLTLAEDTAVGSTILTIQATDADEP
FTGSSKILYRITQGDDEGRLGIDTDPQNNTGYVIIKKPLDFETTAIHNIVFQAENPEPLV
PGVQYNASSFATFTLFVTDVNEAPQFPLHIFQAKVSEDVAIGTKVGNMIAKDPEGLDI
Download sequence
Identical sequences G1PCJ1
ENSMLUP00000008132 ENSMLUP00000008132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]