SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PCQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PCQ3
Domain Number 1 Region: 579-873
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.05e-76
Family Protein kinases, catalytic subunit 0.0000238
Further Details:      
 
Domain Number 2 Region: 419-533
Classification Level Classification E-value
Superfamily PH domain-like 1.09e-34
Family Pleckstrin-homology domain (PH domain) 0.0000256
Further Details:      
 
Domain Number 3 Region: 137-206
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.42e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0007
Further Details:      
 
Domain Number 4 Region: 258-323
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.5e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1PCQ3
Sequence length 893
Comment (tr|G1PCQ3|G1PCQ3_MYOLU) Serine/threonine-protein kinase {ECO:0000256|PIRNR:PIRNR000552} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=PRKD3 OC=Vespertilionidae; Myotis.
Sequence
MSANNSPPSAQKSVLPATLPAVLPTPSSCSSPKTGLSARLSNGSFSAPSLTNSRGSVHTI
SFLLQIGLTRESVTIEAQELSLSAVKDLVCSIVYQKFPECGFFGMYDKILLFRHDLNSEN
ILQLITSCLPLHFGGALFPVLPGALATVEDFQIRPHTLYVHSYKAPTFCDYCGEMLWGLV
RQGLKCEGCGLNYHKRCAFKIPNNCSGVRKRRLSNVSLPGPGLSVPRPLQTEYVALPTEE
SHVHQEPSKRIPSWSGRPIWMEKMVMCRVKVPHTFAVHSYTRPTICQYCKRLLKGLFRQG
MQCKDCKFNCHKRCASKVPRDCLGEVTFNGEPSSLGTESDIPMDIDSSDMNSDGGRGLDD
MEEPSPPEDKMFFLDPSDLDVERDEEAVKTISPSTSNNIPLMRVVQSIKHTKRKSSTMVK
EGWMVHYTSRDTLRKRHYWRLDSKCLTLFQNESGSKYYKEIPLSEILRISSPQDFTNISQ
GSNPHCFEIITDTMVYFVGENNGDSSHNPVLAATGIGLDVAQSWEKAIRQALMPVTPQAS
ICTSPGQGKDHKDLSTSISVSNCQIQENVDISTVYQIFADEVLGSGQFGIVYGEIGKHRK
TGRDVAIKVIDKMRFPTKQESQLRNEVAILQNLHHPGIVNLECMFETPERVFVVMEKLHG
DMLEMILSSEKSRLPERITKFMVTQILVALRNLHFKNIVHCDLKPENVLLASAEPFPQVK
LCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRSKGYNRSLDMWSVGVIVYVSLSGTFPFN
EDEDINDQIQNAAFMYPPNPWKEISGEAIDLINNLLQVKMRKRYSVDKSLSHPWLQDYQT
WLDLREFETRIGERYITHESDDARWEIHAYTHNLVYPKHFIMAPNPDDMEEDP
Download sequence
Identical sequences G1PCQ3
ENSMLUP00000008206 ENSMLUP00000008206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]