SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PE12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PE12
Domain Number 1 Region: 1197-1410
Classification Level Classification E-value
Superfamily VPS9 domain 3.4e-52
Family VPS9 domain 0.00013
Further Details:      
 
Domain Number 2 Region: 95-467
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.18e-46
Family p120GAP domain-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1PE12
Sequence length 1413
Comment (tr|G1PE12|G1PE12_MYOLU) GTPase activating protein and VPS9 domains 1 {ECO:0000313|Ensembl:ENSMLUP00000008732} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=GAPVD1 OC=Vespertilionidae; Myotis.
Sequence
MVKLDIHTLAHHLKQERLYVNSEKQLIQRLNADVLKTAEKLYRTAWIAKQQRINLDRLII
TSAEASPAECCQHAKILEDTQFVDGYKQLGFQETAYGEFLSRLRENPRLIASSLVAGEKL
NQENTQSVIYTVFTSLYGNCIMQEDESYLLQVLRYLIEFELKESDNPRRLLRRGTCAFSI
LFKLFSEGLFSAKLFLTATLHEPIMQLLVEDEDHLETDPNKLIERFSPSQQEKLFGEKGS
DRFRQKVQEMVDSNEAKLVTLVNKFIGYLKQNTYCFPHSLRWIVSQMYKTLSCVDRLEVG
EVRAMCTDLLLACFICPAVVNPEQYGIISDAPINEVARFNLMQVGRLLQQLAMTGSEEGD
PRTKGSLGKFDKSCVAAFLDVVIGGRAVETPPMSSVNLLEGLSRTVVYITYSQLITLVNF
MKSVMSGDQLREDRMALDNLLANLPQAKPGKSSSLEMTPYNTPQLSPATTPANKKNRLPI
ATRSRSRTNVLMDLHMDHEGSSQETIPEVQPEEVLVISLGTGPQLTPGMMSENEVLNMQL
SDGGQGDVPVDENKLHGPSNRSNSVSSLDLEGESVSELGAGPSGSNGADALQLLEHEQAT
TQDNLDDKLRKFEIRDMMGLTDDRDISETVSETWSTDVLGSDFDPNIDEDRLQEIAGAAA
ENMLGSLLCLPGSGSVLLDPCTGSTISETTSEAWSVEVLPSDSEAPDLKQEERLQELESC
SGLGSTSDDTDVREVSSRPSTPGLSVVSGISATSEDIPNKIEDLRSECSSDFGGKDSVTS
PDMDEVTHGAHHLTSPPSQSESLLAMFDPLSSHEGASAVVRPKVHYARPSHPPPDPPILE
GAVGGNEARLPNFGSHGLTPAEMEAFKQRHSYPERLVRSRSSDIVSSARRPMSDPSWNRR
PGNEERELPPAAAIGATSLVAAPHSSSSSPSKDSSRGETEERKDSDDEKSDRNRPWWRKR
FVSAMPKDDPSPRLSAQAQAAEDILDKYRNAIKRTSPSEGAMANYDNAEAMGDGESAHDS
PRDEALQNISADDLPDSASQVAHPQDSAYSYRDAKKKLRLALCSADSVAFPVLSHSTRNG
LPDHTDPEENEIVCFLKVQIAEAINLQDKNLMAQLQETMRCVCRFDNRTCRKLLASIAED
YRKRAPYIAYLTRCRQGLQTTQAHLERLLQRVLRDKEVANRYFTTVCVRLLLESKEKKIR
EFIQGDFQKLTAADDKTAQVEDFLQFLYGAMAQDVIWQNASEEQLQDAQLAIERSVMNRI
FKLAFYPNQDGDILRDQVLHEHIQRLSKVVTANHRALQIPEVYLREAPWPSAQSEIRTIS
AYKTPRDKVQCILRMCSTIMNLLSLANEDSVPGADDFVPVLVFVLIKANPPCLLSTVQYI
SSFYASCLSGEESYWWMQFTAAVEFIKTIDDRK
Download sequence
Identical sequences G1PE12
ENSMLUP00000008732 ENSMLUP00000008732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]