SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PE60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PE60
Domain Number 1 Region: 28-458
Classification Level Classification E-value
Superfamily Ras GEF 3.92e-102
Family Ras GEF 0.00058
Further Details:      
 
Domain Number 2 Region: 519-587
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.14e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0011
Further Details:      
 
Domain Number 3 Region: 366-385,454-524
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000279
Family Calmodulin-like 0.036
Further Details:      
 
Weak hits

Sequence:  G1PE60
Domain Number - Region: 742-777
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.085
Family Mitotic arrest deficient-like 1, Mad1 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1PE60
Sequence length 792
Comment (tr|G1PE60|G1PE60_MYOLU) RAS guanyl releasing protein 1 {ECO:0000313|Ensembl:ENSMLUP00000008788} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=RASGRP1 OC=Vespertilionidae; Myotis.
Sequence
PRKPSHGCRAAPKAKLEAKPASSPFPSHPSLAQITQFRMMVSLGHLAKGASLDDLIDSCI
QSFDADGNLCRSNQLLQVMLTMHRVIISSAELLQKVIPTYKDAWAKKSPGLCLKICYFVR
YWITEFWTMFKMDASLTNTMEEFQELVKASGEELHCRLIDTTQMFTHKSNARDWSRKLTQ
RIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYAVNSCVKENPTME
RSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIQVAQKLHQLQNFNTLMAVIGGLCHSS
ISRLKETSSHVPHEINKVLGEMTELLSSCRNYDNYRRAYGECTHFKIPILGVHLKDLISL
YEAMPDYLEDGKVNVHKLLALYNHINELVQLQEVAPPLEANKDLVHLLTLSLDLYYTEDE
IYELSYAREPRNHRAPPLTPSKPPVVVDWASGVSPKPDPKTISKHVQRMVDSVFKNYDHD
QDGYISQEEFEKIAASFPFSFCVMDKDREGLISRDEITAYFMRASSIYSKLGLGFPHNFQ
ETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRAKNSAALTDNS
TAVGPTFNLCSLGAKDLLHAPEDGPFPFPNGEAVEQSEESKDRTIMLMGVSSQKISVRLK
RTVAHKATQTEALHWMGSEGPSGPFALSSPRKTAQDTLYVLPSPTSPCPSPVLVRKRAFV
KWENKDSFMKSKEELRHLRLPTYHELEQEINTLKADNDALKIQLRYAQKKIESLQLAKSN
HVLAQMEQGDSS
Download sequence
Identical sequences G1PE60
ENSMLUP00000008788 ENSMLUP00000008788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]