SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PF15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PF15
Domain Number 1 Region: 30-235
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.65e-62
Family BAR domain 0.0000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1PF15
Sequence length 566
Comment (tr|G1PF15|G1PF15_MYOLU) Bridging integrator 2 {ECO:0000313|Ensembl:ENSMLUP00000009136} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=BIN2 OC=Vespertilionidae; Myotis.
Sequence
MAEGKAGGAAGLFAKQVQKKFSRAQEKVLQKLGKTVETKDERFEQSANNFYQQQAEGLKL
YKELKNFLSAVKVMHESSKRVSETLQEIYSSEWDGHEELKAIVGNNDLLWEDYEEKLADQ
ALRTMENYVAQFGEIKERIAKRGRKLVDYDSARHHLEAVQNAKKKDEAKIAKADEEFNKA
QLVFEDLNQELLEELPVLYNSRIGCYVTIFQNISNLKDVFYREMSKLNHNLYEVMSKLEK
QHSNKVFVVKGLSSSSRRSLVISSPVRTSTVSSPPTSPTSPSTLSLTSERESISASEEEL
TSDPAQGEDNSEIKEEPLKEKEIEKEEAEANSSEEEQPLPACNGPTQAQPSSPQPTEGGE
SQEEVFSSSPDPSPGSALIPSEQPASLPEVVLRTRTSSEGSKQLKKRTPVQRTSAPPNRP
PPPRGTPSSRTPSGNIPSSPAASEPGSPTSPRASLGTGPPSPSSRATFEIPLDPPQKPVR
TEDKEKENTDNLNPDLCTSPTSVTPQGFSESDKASKMEDKEENKLILADSPESQGLRRRA
SVVPEDSNIAAPELQEEVSTIQSAQL
Download sequence
Identical sequences G1PF15
ENSMLUP00000009136 XP_006095725.1.53796 ENSMLUP00000009136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]