SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PF24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PF24
Domain Number 1 Region: 946-1167
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-34
Family DBL homology domain (DH-domain) 0.0016
Further Details:      
 
Domain Number 2 Region: 1327-1528
Classification Level Classification E-value
Superfamily PH domain-like 6.76e-34
Family Pleckstrin-homology domain (PH domain) 0.0000854
Further Details:      
 
Domain Number 3 Region: 1173-1275
Classification Level Classification E-value
Superfamily PH domain-like 3.85e-20
Family Pleckstrin-homology domain (PH domain) 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1PF24
Sequence length 1530
Comment (tr|G1PF24|G1PF24_MYOLU) FYVE, RhoGEF and PH domain containing 5 {ECO:0000313|Ensembl:ENSMLUP00000009146} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=FGD5 OC=Vespertilionidae; Myotis.
Sequence
PNSTLSSQQRCPSLLFHPLDSPKPPVAPKPKNASPLTPVTAPKFPSSPRPDSLHSPNSMS
RGPKPPIAPKPRLDTPNEWRASVYMINSLNKCSNGKLLCVDKGLYEEQQSNLECSEAEAD
EDYIVVPRAPPTEDEPRDGDSVENAVTVPPDATGEEEPQEEGEEEGTGAAEEVAAPAEMA
LGGETDEGVAPIPEKVRADDYAQDPEEEEQKLTNEEEEKLVEEHNMYNLEDRGPWDGEAV
FSSDIILTQVDLEDPESPGKELGPLGTPREAEEDGEEGCAKTEPGVPDEPTEEGAEDTSE
EPLENEGLATGIQEGEIVTDNPDVSEEECEDATSGGNRDDQDEPPDQEEKTDQEEMAAVI
QEAREDVAESEDSVQDEPAEESCQIIPFENDCMDDFVTSLSGSPYEFFPTESTSFCGESY
SSFSESAKGLESEQESKSGECADQDTVAGTLRGQHGSLQDGTGEGFSVPNVLVLPEDEDA
TDDALTNPYELGVDLVCGTDPGEGEKPETQAASDALSGYGSKEELNSDAEGGLMPIDRKN
IISRARPHSGKVPGYVPETVPEEAGPEAVSSSAIGIGGATEEARKMVLSLEGKPLEVSRA
LPAKPRAFTLYPRSFSVEGREIPVSVYREPEASGLADHRIKRKDDNLSLPCVIGSSGSFS
QRNHLPSSGTSTPSSMVDIPPPFDLACITKKPITKSSPSLLIESEPPDKHSKKKKSSFKR
FLALTFKKKTENKVHVEVNVSSSRSSSESSYHGPSRLLEIDRRSLSNSPQLKTRTGKLRA
SESPSSLIFYRDGKRKGIPFSRTVSRVESFEDRSRPPFLPLPLTKPRSISFPNADTSDYE
NIPAMNSDYENIQIPPRRPARAGTFTKLFEDQSRALSTANENDGYVDMSSFNTFENKQVS
SEQPYPSAYTEPYKVCPISAAAPKEDLTSDEEQGSSEEEDSASRDPSLTNKVEGQSRAHV
IAQELLSSEKAYVEMLQHLHLDFHGAVVRALDEMDQEGKDTLAREELRRGLSELPAILNL
HQGILEELGERLLHCCREGQQKVADVFLAREQEFDHHAAHILQFDRYLSLLAENCLHSPR
LAAAVREFEELQSQQGGGQNVKHRLLRVVQRLFQYQVLLTDYLNNLSPDSAEYDNTQGAL
TLISKVTDHANESMEQGENLQKLSTLRQARGQGDLLQPGREFLKEGTLMKVTGKNRRPRH
LFLMSDMLLYTYPQKDGKYRLKNTLAVASMKVSRPVMEKVPYALKIETSESCLTLSASSC
AERDEWHGCLSRALPEDYKAQALAAFHHSVEIRERLGVSLGERPPTLVPVTHVMMCMNCG
CDFSLTLRRHHCHACGKIVCRNCSRNKYPLKYLKDRMAKVCDGCYGELKKRGGDVPGLMR
ERPVSMSFPLSSPRFSSSSFSSVFHSINPSTFKKQKKVPSALTEVAASGEGSAISGYLSR
CKKGKRHWKKLWFVIKGKVLYTYMASEDTVAMESMPLLGFTIAPEKEEGSSEVGPVFHLY
HKKTLFYSFKAEDTNSAQRWIEAMEDASVL
Download sequence
Identical sequences G1PF24
ENSMLUP00000009146 ENSMLUP00000009146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]