SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PF52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PF52
Domain Number 1 Region: 183-197,323-584
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-63
Family Nuclear receptor ligand-binding domain 0.0000672
Further Details:      
 
Domain Number 2 Region: 114-196
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.05e-32
Family Nuclear receptor 0.0000738
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1PF52
Sequence length 596
Comment (tr|G1PF52|G1PF52_MYOLU) Nuclear receptor subfamily 2 group C member 2 {ECO:0000313|Ensembl:ENSMLUP00000009178} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=NR2C2 OC=Vespertilionidae; Myotis.
Sequence
MTSPSPRIQIISTDSAVASPQRIQIVTDQQTGQKIQIVTAVDTSGSPKQQFILTSPDGAG
TGKVILASPETSSAKQLIFTTSDNLVPGRIQIVTDSASVERLLGKAEVQRPQVVEYCVVC
GDKASGRHYGAVSCEGCKGFFKRSVRKNLTYSCRSNQDCIINKHHRNRCQFCRLKKCLEM
GMKMESVQSERKPFDVQREKPSNCAASTEKIYIRKDLRSPLIATPTFVADKDGARQTGLL
DPGMLVNIQQPLIREDGTVLLATDSKAETSQGALGTLANVVTSLANLSESLNNGDTSEVQ
PEDQSASEITRAFDTLAKALNTTDSSSPPSLADGIDTSGGGSIHVISRDQSTPIIEVEGP
LLSDTHVTFKLTMPSPMPEYLNVHYICESASRLLFLSMHWARSIPAFQALGQDCNTSLVR
ACWNELFTLGLAQCAQVMSLSTILAAIVNHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCN
SMAKLDIDGYEYAYLKAIVLFSPDHPGLTSTSQIEKFQEKAQMELQDYVQKTYSEDTYRL
ARILVRLPALRLMSSNITEELFFTGLIGNVSIDSIIPYILKMETAEYNGQITGASL
Download sequence
Identical sequences G1PF52 L5M7Y7
XP_006083861.1.53796 XP_006758376.1.95426 XP_014398204.1.60319 ENSMLUP00000009178 ENSMLUP00000009178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]