SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PF58 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PF58
Domain Number 1 Region: 683-793
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000000368
Family Regulator of G-protein signaling, RGS 0.01
Further Details:      
 
Domain Number 2 Region: 122-229
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000191
Family Regulator of G-protein signaling, RGS 0.0071
Further Details:      
 
Domain Number 3 Region: 401-523
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000721
Family Regulator of G-protein signaling, RGS 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1PF58
Sequence length 984
Comment (tr|G1PF58|G1PF58_MYOLU) Regulator of G protein signaling like 1 {ECO:0000313|Ensembl:ENSMLUP00000009184} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=RGSL1 OC=Vespertilionidae; Myotis.
Sequence
SPHIEIICSTNLIILLEDEIFADFFNTFLSLPVFGQTPFYTVENAQWSLWPEIPHDLIPK
YKGLLTWLGKYRLPFFCKTNLCFHYILCQELISFINSPEGAKMMRWKKADQWLLQKCIGG
VRGMWRFCTYLKGSAGEELVDFWILAEKILGIDEMDLELRDHYLSLLLVLKATHLQEGSR
VVTLCNMNIKSLLNLSIWHPNQSTTRREILSNMQKVALFKLQSYWLPNFHIHAKTIIAKE
ETCQHLMQEYETRQCSLCCSHLGELPLNMSIKKSCHPQRRYSSRKIKQKMWQLIDHASWS
LELDTKPGDNSTSSQEICPQEKVVVHMPSLKKASSKEGITSSLEKDSLSARKSNMKKKAK
SHLHMEGLFETKISTHLRTATPIIRHSPHLTIKGAIKKRLSLGYTHWALCADAFAGSPFR
DHLKKLNLKMEIQLLDLWQDLHHFLNVLMNNRKTGNAIFWHILGNRICELYLNEQIGPRL
PLKSQTIEGLKELLPSGNMNPWIPKAQEEICQMLSSWYEEFLNEEDSSFLTYATQTSVNH
TRRHKKDAISKQENILLYKRLEESLALSQGLANMEEMDSVQWRKLATEDLRHDGSLRVEL
KSPVFLTDIEKMSFEELCYKYPKVAIEKISEDYKIYCKKAPTNYQYKVYRQIITRESRTH
SPPPKEASLKKIPVVRKPSHRPRNLAEVFRNVQHLEYFTEFLKERKAEVPLQFLMALQKI
SIETDEQVSKSLVENVMETYFSDIVPAEEMLQCDDPIIREVSRKGRLSTNSMLILQSCVM
KSLEEKWFKEYQELFPDFPQEVQAQIRTVYRKPSKTSSMQIQEPQKRIWPKLVGFVKSFC
KYRRCMNNVNLRQEFEKYLHLELNNKENYPASPNVPARPSPHHSNVRSAEENGDVIFMKR
RIFGHRVITVNFALSDLYFFSEMERFNDLVSSAHVLQVSWAYNENDVILMKSKINIILKL
YLQSEVPPRLRVLFLEGNPLLLPE
Download sequence
Identical sequences G1PF58
ENSMLUP00000009184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]