SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PF76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PF76
Domain Number 1 Region: 411-716
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.39e-52
Family Eukaryotic proteases 0.00064
Further Details:      
 
Domain Number 2 Region: 119-235
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.59e-33
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 3 Region: 276-346
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000236
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 4 Region: 230-271
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000163
Family EGF-type module 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1PF76
Sequence length 716
Comment (tr|G1PF76|G1PF76_MYOLU) Peptidase domain containing associated with muscle regeneration 1 {ECO:0000313|Ensembl:ENSMLUP00000009204} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=PAMR1 OC=Vespertilionidae; Myotis.
Sequence
LGCAGQLCQDLCPYLLVSISEYTVINEACPGAEWNIMCRECCEYDQIECVCPGKKEVVGY
TIPCCRNEDNECDSCLIHPGCTIFENCKTCRNGSWGGTLDDFYVKGFYCAECRAGWYGGD
CMRCGQVLRASKGQIFLESYPLNAHCEWTIHAKPGFNIQLRFVMLSLEFDYMCQYDYVEV
RDGDNSDGQIIKRFCGNERPAPIRSTGSSLHILFHSDGSKNFDGFHAIFEEITACSSSPC
FHDGTCLVDQTGSYRCACLAGYTGRRCENLIEERNCSDPGGPVNGYKKITGGPGLINGRH
AKVGTVFSFFCNSSYVLSGNENRTCQQSGAWSGKQPICIKACREPKISDLVRRRVLPMQV
QSRETPLHQLYSSTFSKQKLQGVPTKKPALPFGDLPTGYQHLHTQLQYECISPFYRRLGS
SRRTCLRTGKWSGRAPSCIPSLGSLHPTRQPKTQGLRWPWQAAIYRRVSGVHGGSLHKDE
WFLVCSGALVNERTVVVAAHCVTDLGKVTMVKTADLKVVLGKFYRDDDRDEKTIQSLRIS
AIILHPNYDPILLDADIAVLKLLDKARISTRVQPICLAATRDLSTAFQEAHITVAGWNVL
ADVRSPGYKNDMLRSGVFRVVDSLMCEEQHEEHGIPVSVTDNMFCASRDPAAPSDICTAE
TGGIAAVSFPGQASPEPRWHLVGLVSWSYDKTCSHSLYTAFSKVLPFKDWIERNMK
Download sequence
Identical sequences G1PF76
ENSMLUP00000009204 ENSMLUP00000009204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]