SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PFW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PFW6
Domain Number 1 Region: 160-481
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.41e-128
Family Mammalian PLC 0.0000000000516
Further Details:      
 
Domain Number 2 Region: 3-155
Classification Level Classification E-value
Superfamily EF-hand 6.45e-46
Family EF-hand modules in multidomain proteins 0.000000756
Further Details:      
 
Domain Number 3 Region: 489-614
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.17e-32
Family PLC-like (P variant) 0.00000456
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1PFW6
Sequence length 616
Comment (tr|G1PFW6|G1PFW6_MYOLU) Phosphoinositide phospholipase C {ECO:0000256|RuleBase:RU361133} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=PLCD1 OC=Vespertilionidae; Myotis.
Sequence
LPSWIHSCLRKADKNKDNKMSFKELQNFLKELNIQVDDSYARKIFRECDRSQTDSLEDEE
IEAFYKMLTQRKEIDRTFEEAAGSGQTLSVDQLVTFLQHQQREEAAGPALALSLIERYEP
SETAKAQRQMTKDGFLMYLLSADGSAFNLAHRRVYQDMGQPLSHYLVSSSHNTYLLEDQL
TGPSSTEAYIRALCKGCRCLELDCWDGPNQEPIIYHGYTFTSKILFCDVLRAIRDYAFKA
SPYPVILSLENHCSLEQQRVMARHLSTTLGSMLLDRPLEGVTTSLPSPEQLKGKILLKGK
KLGGLLPPSGEGGPEATVVSDEDEAAEMEDEAVRSRVQHKPKEDKLRLVKELSDMVIYCK
SVHFRGFSSPGSPGQAFYEMASFSENRTLRLLQESGTSLVRHNVNHLSRIYPAGWRTDSS
NYSPVEMWNGGCQIVALNFQTPGPEMDVYQGRFQDNGACGYVLKPAFLRDPNSTFNPRNP
AQGPWWTRKRLNIWVITGQQLPKVNKSKNSIVDPKVTVEVHGVGRDVASRQTAVVTNNGF
NPWWDTEFEFEVAVPELALVRFVVEDYDASSKNDFIGQSTIPLNSLKQGYRHVHLLSKNG
DQHPSATLFVKVSLRD
Download sequence
Identical sequences G1PFW6
ENSMLUP00000009497 ENSMLUP00000009497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]