SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PG19 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PG19
Domain Number 1 Region: 264-607
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.1e-73
Family p120GAP domain-like 0.0000866
Further Details:      
 
Domain Number 2 Region: 112-237
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.02e-33
Family Synaptotagmin-like (S variant) 0.0026
Further Details:      
 
Domain Number 3 Region: 566-707
Classification Level Classification E-value
Superfamily PH domain-like 2.66e-32
Family Pleckstrin-homology domain (PH domain) 0.0049
Further Details:      
 
Domain Number 4 Region: 13-129
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.26e-22
Family PLC-like (P variant) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1PG19
Sequence length 802
Comment (tr|G1PG19|G1PG19_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000009557} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=LOC102428580 OC=Vespertilionidae; Myotis.
Sequence
FPQKKSLFEKGSRAWNSPAYNTNGSSDPYCIVKVDNEPIIRTATVWKTLCPFWGEEYQVH
LPPTFHAVAFYVMDEDALSRDDVIGKVCLTKDTLAAHPKGFSGWAHLTEVDPDEEVQGEI
HLRLELVPGARAGRLRCSVLEARDLAPKDRNGASDPFVRVRYNGRTQETSIVKKSCYPRW
NETFEFEVEEGATEALCVEAWDWDLVSRNDFLGKVVVNVQRLWAAQQEEGWFQLQPDLPK
RRREEGNLGSLQLEVRLRDETVLPSGCYQPLVQLLCREVKLGTQGPAQLIPLIEEMTSTE
CRQEVATNLLKLFLGQGLAKGFLDLLFQLELSRTNEANTLFRSNSLATKSMESFLKVAGM
RYLHSILGPIIDRVFEEKKYVELDPSKVEVKDVGCSGLHRPQTEAEVLQQSARTLSAHLG
ALLSALCRSVRACPAVVRATFRQLFLRVRERFPSAQHENVPFIAVTSFLCLRFVSPAIMA
PKLFHLRERHADARTSRTLLLLAKAIQNVGNMDTPASRAKEAWMEPLQPTVRQGVAQLKD
FITKLVDIEEKEELDLQRALSLQMPPVKEGPLFIHRTKGKGPLMSSSFKKLYFSLTTEAL
SFAKTPSSKKSALIKLANIRAAEKVEEKSFGSSHVMQVIYTDDTGRPQTAYLQCKCVNEL
NQWLSALRKVSINNTGLLGSYHPGVFRGDKWSCCHQKDKTDLGCDRTRSRVTLQEWNDPL
DHDLEAQLIYRHLLGMEAALREKHQQLSAGTGAGPTLTGPGEAPEDRLAQLLQVLQDLRE
AHSCSPASSPASEPNCLLELQT
Download sequence
Identical sequences G1PG19
ENSMLUP00000009557 ENSMLUP00000009557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]