SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PG76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PG76
Domain Number 1 Region: 167-302,410-663
Classification Level Classification E-value
Superfamily Ras GEF 5.62e-86
Family Ras GEF 0.0002
Further Details:      
 
Domain Number 2 Region: 310-418
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.7e-33
Family Ras-binding domain, RBD 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1PG76
Sequence length 665
Comment (tr|G1PG76|G1PG76_MYOLU) Rap guanine nucleotide exchange factor like 1 {ECO:0000313|Ensembl:ENSMLUP00000009622} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=RAPGEFL1 OC=Vespertilionidae; Myotis.
Sequence
MKPLEKFLKKQTSQLAGRTVAGGPGGGPGSCGGPGGGGGPGGGGGSAGGPRPLQRRQSVS
RLLLPAFLREPPAEPGLEPPPEEEGGEPAGVTEELGGSGGPCWLQLEEVPGPGPLGGGGP
LRSPSSYSSDELSPGEPLASPPWAPLGPERPEHLLNRVLQRLAGGATRDSAASDILLDDI
VLTHSLFLPTEKFLQELHHVGVSFVSAGGREGPEGLGQKQACLAMLLHFLDTYQGLLQEE
EGAGRIIKDLYLLIMKDESLYQDLREDTLRLHQLVETVELKIPEESQPPNKQVKPLFRHF
RRIDSCLQTRVAFRGSDEIFCRVYMPDHSYVTIRSRLSASVQDILGSVTEKLQYSEEPAG
REDSLILVAVASSGEKVLLQPTEDCVFTTLGINSHLFACTRDSYEALVPLPEEIQVSPGD
TEIHRVEPEDVANHLTAFHWELFRCVHELEFVDYVFHGERGRRETANLELLLQRCSEVTH
WVATEVLLCEAQGKRVQLLKKFIKIAAICKQNQDLLSFYAVVMGLDNAAVSRLRLTWEKL
PGKFKNLFRKFENLTDPCRNHKSYRDVISKMKPPVIPFVPLILKDLTFLHEGSKTLVDGL
VNIEKLHSVAEKVRTVRKYRSRPLCLDMEASPHHLQTKAYVRQFQVIDNQNLLFELSYKL
EANSQ
Download sequence
Identical sequences G1PG76
ENSMLUP00000009622 ENSMLUP00000009622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]