SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PGA3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PGA3
Domain Number 1 Region: 70-374
Classification Level Classification E-value
Superfamily Ferritin-like 1.11e-117
Family Ribonucleotide reductase-like 0.0000000000748
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1PGA3
Sequence length 393
Comment (tr|G1PGA3|G1PGA3_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000009654} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=RRM2 OC=Vespertilionidae; Myotis.
Sequence
MLSVRRPLAPLAPLADPQQLKLSPLKGLSLADKENTPPSLNGTRVLASKTARRIFQEPAE
PKTPVPAPGAQEEPLLRENPRRFVVFPIEYHDIWQMYKKAEASFWTAEEVDLSKDLQHWE
ALKSDERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYS
LLIDTYIKDPKEREFLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFS
GSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLLHKPAEQRVKEIITNAV
RIEQEFLTEALPVKLIGMNCTLMKRYIEFVADRLLLELGFSKVVFRVENPFDFMENISLE
GKTNFFEKRVGEYQRMGVMSSPTENSFTLDADF
Download sequence
Identical sequences G1PGA3
ENSMLUP00000009654 ENSMLUP00000009654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]