SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PGK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PGK0
Domain Number 1 Region: 145-468
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.2e-51
Family Diacylglycerol kinase-like 0.0078
Further Details:      
 
Domain Number 2 Region: 42-107
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000105
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1PGK0
Sequence length 493
Comment (tr|G1PGK0|G1PGK0_MYOLU) Diacylglycerol kinase {ECO:0000256|RuleBase:RU361128} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=DGKE OC=Vespertilionidae; Myotis.
Sequence
VCAQHILQGASADCCGLRVGRGLPQEGPTSASSAKEIVLKPDAKALDAMPHHWIRGNVPL
CSCCVVCTQQCGSQPKLCDYRCIWCQKTVHDECMRSSLKNETCDFGEFRNLIIPPSYLTS
INQMRKDKKTDYAMLASKLGKQWTPLIILANSRSGTNMGDGLLGEFRILLNPVQVFDVTK
TPPIKALQLCTLLPYHSARVLVCGGDGTVGWVLDAIDEMKIKGQEKYIPQVAVLPLGTGN
DLSNTLGWGTSYTGEIPVAQVLRNVMEADGIKLDRWKVQVTNKGYYNLRKPKEFTMNNYF
SVGPDALMALNFHAHREKAPSLFSSRILNKAVYLFYGTKDCLVQECKDLNKKVELELDGE
RVELPNLEGIIVLNIGYWGGGCRLWEGMGDETYPLARHDDGLLEVVGVYGSFHCAQIQVK
LANPFRIGQAHTVRLILKCSMMPMQVDGEPWAQGPCTVTITHKTHALMLYFSGEQTDDDV
SSNSDQEDIKDTE
Download sequence
Identical sequences G1PGK0
ENSMLUP00000009767 ENSMLUP00000009767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]