SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PGW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PGW6
Domain Number 1 Region: 159-543
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.07e-158
Family Myotubularin-like phosphatases 0.00000000003
Further Details:      
 
Domain Number 2 Region: 35-155
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-41
Family GRAM domain 0.0000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1PGW6
Sequence length 603
Comment (tr|G1PGW6|G1PGW6_MYOLU) Myotubularin 1 {ECO:0000313|Ensembl:ENSMLUP00000009897} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=MTM1 OC=Vespertilionidae; Myotis.
Sequence
MASAPTSKYNSRSLENESIKRTSRDGVNRDLSEAVPRLPGEIRITDKEVIYICPFNGPIK
GRVYITNYRLYLRSLETDSALILDVPLGVISRIEKMGGATSRGENSYGLDITCKDMRNLR
FALKQEGHSRRDMFEILTRHAFPLAHSLPIFAFVNEEKFNVDGWMVYNPVEEYRRQGLPN
HHWRITFINKCYELCDTYPPLLVVPFRATDEDLKRVATFRSRNRIPVLSWIHPENKTVIV
RCSQPLVGMSGKRNKDDEKYLDVIRETNRQISKLTIYDARPSVNAVANKATGGGYESDDA
YHNTELFFLDIHNIHVMRESLKKVKDIVYPNVEESHWLSSLESTHWLEHIKLILTGAIQV
ADKVSSGRSSVLVHCSDGWDRTAQLTSLAMLMLDSFYRSIEGFEILVQKEWISFGHKFAS
RIGHGDKNHADADRSPIFLQFIDCVWQMSKQFPTAFEFNERFLMTILDHLYSCRFGTFLY
NCESARERQKVTERTVSLWSLINSNKDTFKNPFYTKEINRVLYPVASMRHLELWVNYYIR
WNPRIKQQQPNPVEQRYMELLALRDEYIKRLEELQLANSAKLSDPSTSPSSPSQMLPHVQ
THF
Download sequence
Identical sequences G1PGW6
ENSMLUP00000009897 XP_006087798.1.53796 XP_006087799.1.53796 ENSMLUP00000009897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]