SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PH51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PH51
Domain Number 1 Region: 1-139
Classification Level Classification E-value
Superfamily PH domain-like 3.91e-49
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.000000229
Further Details:      
 
Domain Number 2 Region: 213-344
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000124
Family Tropomyosin 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1PH51
Sequence length 364
Comment (tr|G1PH51|G1PH51_MYOLU) Homer scaffolding protein 1 {ECO:0000313|Ensembl:ENSMLUP00000009991} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=HOMER1 OC=Vespertilionidae; Myotis.
Sequence
EQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINSTIT
PNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSQEKME
LTSTPSQESAGGDLQSPLTPESINGTDDERTPDVTQNSESRAEPTQNALPFSHRKGKTTQ
ILTCMNSAISKHWEAELATLKGNNAKLTAALLESTANVKQWKQQLAAYQEEAERLHKRVT
ELECVSSQANAVHTHKTELNQTIQELEETLKEKEEEIERLKQEIDNARELQEQRDSLTQK
LQEVEIRNKDLEGQLSDLEQRLEKSQSEQEAFRNNLKTLLDILDGKIFELTELRDNLAKL
LECS
Download sequence
Identical sequences G1PH51
ENSMLUP00000009991 ENSMLUP00000009991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]