SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PHB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PHB5
Domain Number 1 Region: 11-284
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.93e-55
Family FCH domain 0.0014
Further Details:      
 
Domain Number 2 Region: 451-555
Classification Level Classification E-value
Superfamily SH2 domain 1.12e-30
Family SH2 domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1PHB5
Sequence length 557
Comment (tr|G1PHB5|G1PHB5_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000010059} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN= OC=Vespertilionidae; Myotis.
Sequence
MGFGSDLKNSHEAVLKLQDWELRLLETVKKFMALRIKSDKEYASTLQNLCNQVDKESTIQ
VNYVSNVSKSWLLMIQQTEQLSRIMKTHAEDLNSGPLHKLTMMIKDKQQVKKSYIAVHQQ
IEAEMIKPNQSVNKVSLPKLKSSYRQLIKEMNSAKEKYTEALAKGKETEKAKERYDKATM
KLHVLHNQYVLALKGAQLHQNQYYDTTLPLLLDSLQMMQEEMIKALKGIFDEYSQITSLV
TEEIVNVHKEIQMSVEQIDPSTEYNNFIDVHRTSATKEQEVEFDTSLLEENENLQANEIM
WNNLTAESLQVKLKTLAEELMQTQQMLLNKEEAVLELEKRIEESSKTYEKKSDIVLLISQ
KQTLEELKQSVQQLRCTEAKFTAQKELLEQKVQENDGKEPPPVINYEEDARSVTSMERKE
RVSKLESFRHSIAGLIRGPKSAFGSTAVKFESMPIIEKPLTEQDWYHGAIPRIEAQDLLK
QQGDFLVRESHGKPGEYVLSVFSDGQRRHFIIQYVDSLYRFEGTGFSNIPQLIEHHFTTK
QVITKKSGVVLLNPIVK
Download sequence
Identical sequences G1PHB5
ENSMLUP00000010059 ENSMLUP00000010059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]