SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PHG9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PHG9
Domain Number 1 Region: 56-182
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.44e-44
Family Regulator of G-protein signaling, RGS 0.000000691
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1PHG9
Sequence length 202
Comment (tr|G1PHG9|G1PHG9_MYOLU) Regulator of G protein signaling 16 {ECO:0000313|Ensembl:ENSMLUP00000010119} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=RGS16 OC=Vespertilionidae; Myotis.
Sequence
MCRTLSAFPTTCLERAKEFKTRLGIFLHKSDLSSDTGNAGKSEWNNKHSKERRNFSEDVL
GWRESFDLLLSSKNGVAAFHAFLKTEFSQENLEFWLACEEFKKIRSASKLASRAHRIFEE
FICSEAPKEVNIDHETRELTRTNLQAATATCFDVAQGKTRTLMEKDSYPRFLKSPAYQDL
AAQASATNASPSSGSSAEPSHT
Download sequence
Identical sequences G1PHG9
ENSMLUP00000010119 XP_006089049.1.53796 ENSMLUP00000010119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]