SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PHI9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PHI9
Domain Number 1 Region: 222-481
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.83e-56
Family Glycerophosphoryl diester phosphodiesterase 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1PHI9
Sequence length 542
Comment (tr|G1PHI9|G1PHI9_MYOLU) Glycerophosphodiester phosphodiesterase domain containing 2 {ECO:0000313|Ensembl:ENSMLUP00000010142} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=GDPD2 OC=Vespertilionidae; Myotis.
Sequence
MAKSPNCCSVWARSIHCLYSCHWRKCPKDRMKTSQCEYMWFGLLFFTVLLSLGWLYIGLI
LLNDLHNFNEFLFRQWGHWMDWSLAFTLFVSLLVTYASLLLLLAVLLWFCGQPLHLHSVH
KVLLLLIVLLVLAGLVVLDVQWQEEWLSLRLSLWATAPFLHIGAVAFITILAWPVADNFY
HIHKIGHKIVLLFVYFTIVLAIYLSPLCISSTCIMEPRDVSPKPRLVGHRGAPMLAPENT
LMSLRKTAECGANVFETDVMISSDGIPFLMHDEHLSRTTDVASVFPTRITAHSSDFSWAE
LKRLNAGAWFLKRPPFWEATQLSGLDRKEAENQTVPTLEELLKEAAVLNLSIMFDLRRPP
RNHTYYDTYVNLTLETVLNSRVPQAMVLWLPDEDRANVQQRAPRMHQIYGQLGVNRTERP
LFLNLPYQDLPQLDINLHRALHEDNVSVNLFVVNKPWLFSILWCAGVDSVTTNDCQLLQQ
MRYPVWLIPPKTYLMIWLLIDCVSTLLILWLFLLRGRCAEKREITGLETAVLLTRINNFI
ME
Download sequence
Identical sequences G1PHI9
ENSMLUP00000010142 ENSMLUP00000010142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]