SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PHP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PHP4
Domain Number 1 Region: 140-298
Classification Level Classification E-value
Superfamily PH domain-like 3.95e-33
Family Pleckstrin-homology domain (PH domain) 0.0000549
Further Details:      
 
Domain Number 2 Region: 2-116
Classification Level Classification E-value
Superfamily PH domain-like 4.44e-22
Family Pleckstrin-homology domain (PH domain) 0.00000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1PHP4
Sequence length 425
Comment (tr|G1PHP4|G1PHP4_MYOLU) Pleckstrin homology domain containing A2 {ECO:0000313|Ensembl:ENSMLUP00000010202} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=PLEKHA2 OC=Vespertilionidae; Myotis.
Sequence
MPYVDRQNRICGFLDIEENENSGKFLRRYFILDTQANYLLWYMDNPQNLAIGAGAVGSLQ
LTYISKVSIATPKQKPKTPFCFVINALSQRYFLQANDQKDLKDWVEALNQASKITVPKVG
NLPLTTEVLKSLAAPPALEKKPQVAYKTEIIGGVVVHTPINQNGGDGQEGGEPGSHAILR
RSQSYIPTTGCRVPTGHPFIKSGYCVKQGNVRKSWKRRFFALDDFSICYFKCEQDREPLR
TIFLKDVLKTHECLVKSGDLLMRDNLFEIITSSRTFYVQADSPEDMHSWIKEIRAAVQAL
KCHPREMSFSRSISLTRSGSSSLSGGPNSVFCRGRPPVEEKKALCKAPSVASSWQPWTPV
PQAGEKLHPPEETLEDSLFTSRLGESNTSGALPSSRIRHRSEPQHPKEKPFMFNLDDENI
RTSDV
Download sequence
Identical sequences G1PHP4
XP_005856499.1.60319 XP_005856501.1.60319 XP_005856502.1.60319 XP_006086310.1.53796 XP_006086311.1.53796 XP_006086312.1.53796 ENSMLUP00000010202 ENSMLUP00000010202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]