SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1PI15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1PI15
Domain Number 1 Region: 2-229
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.13e-69
Family BAR domain 0.0000000557
Further Details:      
 
Domain Number 2 Region: 286-350
Classification Level Classification E-value
Superfamily SH3-domain 6.69e-23
Family SH3-domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1PI15
Sequence length 353
Comment (tr|G1PI15|G1PI15_MYOLU) SH3 domain containing GRB2 like 1, endophilin A2 {ECO:0000313|Ensembl:ENSMLUP00000010330} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=SH3GL1 OC=Vespertilionidae; Myotis.
Sequence
SQLVSEKVGGAEGTKLDDDFKEMEKVLPVTTEKSTSQPTPQPIHWAHSFPASRAKLTMLN
TVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGESMKCLAEVKDSLD
IEVKQNFIDPLQNLCDKDLKEIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFEE
SKEVAETSMHNLLETDIEQVSQLSALVDAQLEYHRQAVQILDELASKLKRRMREASSRPK
REYKPKPRESFDLGEPEQSNGGFPAPKISASSSFRSSDKPVRTPSRSMPPLDQPSCKALY
DFEPENDGELGFHEGDIITLTNQIDENWYEGMLHGQSGFFPLSYVEVLVPLPQ
Download sequence
Identical sequences G1PI15
ENSMLUP00000010330 ENSMLUP00000010330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]